KEGG   Paenibacillus sp. Y412MC10: GYMC10_5704Help
Entry
GYMC10_5704       CDS       T01100                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00620  Pyruvate metabolism
gym00680  Methane metabolism
gym01100  Metabolic pathways
gym01120  Microbial metabolism in diverse environments
gym01200  Carbon metabolism
Module
gym_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GYMC10_5704
  09102 Energy metabolism
   00680 Methane metabolism
    GYMC10_5704
Enzymes [BR:gym01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GYMC10_5704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 ING TipAS
Motif
Other DBs
NCBI-ProteinID: ACX67911
UniProt: D3EKG0
LinkDB All DBs
Position
complement(6394996..6397782)
Genome map
AA seq 928 aa AA seqDB search
MTELTVTAKSNSNNLLRRDVRFLGNILGEVLVHQGGNELLDIVEKIRETSKSLRSVFLPE
LFADFKRIISTLEPDIRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGESVQPGSIE
SAVQDLKERNITFEEVQEILESLSLELVMTAHPTEAMRRAILDIHKRIADDVMQLDNPTL
TFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETLFHILPEVYQELER
CLTKYYPGHHWHVPTYLRFGSWIGGDRDGNPSVTADVTWRTLEMQRKLAIREYQRILREF
MKYLSFSSSIVNVSDELLQSIEKDREHVTLKKMEIWHNEKEPYRVKLVYMLAKMSHILDE
NMTGGERYQTPEEFIEDLKIIDRSLRFHFADYVADTYIQKLIRQAELFGFHTATLDIRQH
SQEHENAMAEILRKMNVTQDYAQLSEDEKIELLNNLLNDPRPLTTPYQEYSDSTEECLEV
YRTVFRAQQEFGVKCISSYLISMAEGASDILEVMVFAKEVGLFRKDNDGSVIATLQAAPL
FETIDDLHAAPDIMRKLFSLPIYREAVSAMNELQEIMLGYSDSNKDGGAITANWELQVAL
KEITAVANEFGIKVKYFHGRGGSLGRGGMPLNRSILAQPASTIAGGIKITEQGEVISSRY
SLKGIAYRSLDQATSALITASLNARYPEKESTEKEWEVISSSISAVSQKKYQDLIFRDPD
FLTFFKESTPLPEVGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAAGTG
LQSFYQGKEENMKVLQQMYTSYPFFTSLIDTLQMALAKADLIIAKEYSLMTKDDQARERI
FGLIQEEFKLTKELVLKITGQQDILDNQPVLQESIRLRNPYVDPLSYLQVQLLNELRELR
EQEQDDPDLLREVLLTINGIAAGLRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacttacagtaaccgcaaaaagcaattccaacaatctgctgcggcgagatgta
cggttccttggcaatattcttggagaagttcttgtccatcaaggaggcaatgagctttta
gatatagttgagaaaattcgcgaaacgagtaaatcgttgcgatccgtattcttgccagaa
ttgtttgcagatttcaaaaggatcatcagcacgctggaacccgacattcgccatcaggtg
attcgcgcgtttgccatttactttcaattggttaacatcgccgaacagaatcatcgcata
cggcgtaaacgcgattacgagcgttccgccggggaaagtgttcaaccaggttccatcgaa
agtgcagtccaggatttgaaagagcgcaatattacgtttgaagaagttcaagaaattctc
gaaagtctatcccttgagctggtgatgaccgctcatccaacagaagcgatgcgtcgggct
attctggatatccataaacggatagcggacgatgtgatgcagctggacaatccgacactg
acgttccgcgaacgggagcagcttcgggagaaactactgaatgaagtgattacgctatgg
caaaccgatgagcttcgtgaccgtaaacctactgttctggatgaagtcagaaacggtatg
tattattttcacgaaaccctgtttcacattctgccagaggtttatcaagaactggagcgc
tgcctaactaaatattatccgggtcaccattggcacgttccaacctatttgcgtttcggt
tcgtggatcggtggcgatcgggacggaaatccttcagtgacggcggacgtaacatggaga
acgcttgaaatgcagcggaagctggcgattcgtgagtaccaacggattttgcgtgaattc
atgaaatacctgagcttcagctcgtcaatcgttaacgtttcggatgaattgcttcaatcc
attgaaaaagaccgcgagcatgtaacactgaagaagatggaaatttggcacaatgagaaa
gagccttatcgtgtaaaactggtatatatgctggctaaaatgagtcacattctggatgag
aacatgacgggcggcgagcgttatcagacccccgaggaattcatcgaggatttgaaaatc
attgatcgaagcctgcgtttccattttgctgactatgttgcagacacctatattcaaaag
ctgattcgccaggcggagttgtttggtttccataccgcaacgctggatatcagacagcat
agccaagagcatgagaatgccatggccgaaattctgcggaaaatgaacgtgacgcaggac
tacgcccaattgagcgaagacgagaagatcgaactgctcaataacttgcttaacgatccg
cgtccgttgactacgccttatcaggagtatagcgacagcaccgaggaatgcctcgaagta
taccgtaccgttttccgtgcgcagcaggaattcggcgtgaaatgcatctccagttatttg
atcagtatggccgagggcgcaagcgacattctggaagtgatggtatttgccaaagaagtc
gggctgttccggaaggataacgacggttccgtaatcgctacgctgcaggctgcgccatta
ttcgagacgattgacgatcttcatgccgccccggatatcatgcgcaagctcttcagcctg
ccgatctaccgtgaagcggtgagcgccatgaacgaactgcaggagatcatgctgggctac
tctgacagcaacaaggacggcggagccattacggcgaactgggagctccaggtagcactc
aaagagattacggccgtagccaatgaattcggcatcaaggtaaaatacttccatggacgc
ggcggatcgctcggacgcggcggtatgcctctgaaccgcagcattttggctcagccggca
tcgaccattgcaggcggcatcaaaattacggagcagggcgaggttatttcgtcccgttac
tccttgaagggcattgcctaccggagtttggatcaggcgacctcagcactgattacggct
tccctgaatgcccgttaccctgaaaaagaatcgaccgaaaaagagtgggaagtgatttcc
tccagcatttcggccgtttctcagaaaaaatatcaggatctgatattccgcgatccggat
ttccttactttcttcaaggaatccacgccgcttcctgaggtgggcgagctgaatattggt
tcccggccttccaagcgcaagaacagcgaccgtttcgaggacctgagagccattccttgg
gtgtttgcatggacgcagagccgttacctgcttccggcatggtacgcggctggtacgggc
ttacagagcttctaccaaggcaaggaagagaatatgaaggtgcttcaacagatgtacacg
agctatccgttctttacgtccctgatcgatacccttcagatggcacttgccaaggcagat
ctgatcatcgccaaggagtattccttgatgacgaaggatgatcaagcacgcgagcgcatc
ttcggtctgattcaggaagaattcaaattgacgaaagagctggttcttaagattacagga
caacaggatattctggataaccagccggttctgcaggaatcgataagactccgcaaccct
tacgtggatccgctcagctatctgcaggttcaactgcttaacgagctgcgtgaactaagg
gagcaggagcaggatgatccggatctgcttcgggaagtactgctgaccatcaacggcatt
gccgccgggcttcgcaatacaggctga

DBGET integrated database retrieval system