KEGG   Halotalea alkalilenta: A5892_05245Help
Entry
A5892_05245       CDS       T04333                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
haa  Halotalea alkalilenta
Pathway
haa00061  Fatty acid biosynthesis
haa00780  Biotin metabolism
haa01100  Metabolic pathways
haa01212  Fatty acid metabolism
Module
haa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:haa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A5892_05245
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A5892_05245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:haa01004]
    A5892_05245
Enzymes [BR:haa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     A5892_05245
Lipid biosynthesis proteins [BR:haa01004]
 Fatty acid synthase
  Component type
   A5892_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ANF56942
UniProt: A0A172YCW8
LinkDB All DBs
Position
1183834..1184277
Genome map
AA seq 147 aa AA seqDB search
MVMDIKEIQEYLPHRYPFLLVDRVVELETGRYIKAYKNVSVNESFFNGHFPGHPIMPGVL
ITEALAQAAGILGFKTVNKLPRDGYIYYYVGSDNVRLKRPVFPGDQLSLEAWMDKSRRGI
WKFTCRAHVGEELVCEADIICAERKIA
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggatatcaaggaaatccaggaatatctgccccaccgctacccgttcctgctg
gtcgaccgcgtcgtcgaactggagacgggtcgctacatcaaggcctataagaacgttagc
gtcaatgagtcgttcttcaacggtcattttcctggccatccgatcatgccgggcgtgctg
atcacggaagcgctggcccaggccgctggtatccttggcttcaaaacggtcaacaagctg
ccgcgtgatggctacatctactactacgtcggcagcgacaacgtgcgcttgaagcgcccg
gtattccccggtgaccagctcagcctggaagcctggatggacaagtcccgccgcggtatc
tggaagttcacctgccgcgcccacgtgggcgaagagctggtctgcgaagccgatatcatc
tgcgcagagaggaagatcgcttga

DBGET integrated database retrieval system