KEGG   Halotalea alkalilenta: A5892_05605Help
Entry
A5892_05605       CDS       T04333                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
haa  Halotalea alkalilenta
Brite
KEGG Orthology (KO) [BR:haa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A5892_05605
Enzymes [BR:haa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A5892_05605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored K_oxygenase FAD_binding_3 AlaDh_PNT_C DAO Glutaredoxin Thi4 DUF1707 Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ANF57007
UniProt: A0A172YCP9
LinkDB All DBs
Position
complement(1274022..1275587)
Genome map
AA seq 521 aa AA seqDB search
MLDANLKTQLKGYLERVTRPIEIVASLDDGDKSRELSTLLRDIESLSDKVSLREDGTDAR
RPSFSLGTPGKQIDLRFAGLPMGHEFTSLVLALLHVGGHPSKASEELIEQIQSIEGEYVF
ETYISLSCQNCPDVVQALNLMAVLNPNIRHTMIDGALFQDEVEKRQIMAVPTVFLNGENF
GQGRMTVEEIVGRLDTGAAAREAEKLNAKQAYDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTLAIENFISVKETEGPKLAAALEEHVKQYDVEIMNLQTAEKLITAKEQGG
LHEVLFANGASLKAKTLIVATGARWRKMNVPGELEYANKGVAYCPHCDGPLFKGKPVAVI
GGGNSGVEAAIDLAGIVSHVTLIEFDTALRADAVLQRKLMSLPNVTVLTNALTTEVVGDG
NKVSGLVYKDRASGEERTVELAGIFVQIGLVPNTDWLKGSIELSGRGEVIIDERGQTSSP
GVFAAGDVTTVPYKQIVIAMGEGAKASLSAFDHLIRITAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctaaaaactcaattgaagggctacctggagcgggtcactcgtcca
atcgagatcgtcgcgtccctggatgacggcgacaagtcgcgtgaactctccaccctgctc
agggacatcgagagcctctccgacaaggtcagcctgcgcgaggacggcaccgacgcacgt
cggccctctttctccctcggcaccccgggcaagcagatcgacctgcgcttcgccggcctg
ccgatgggccacgaattcacttcgctggtgctggcgctgctgcacgtcggcggccatccc
tccaaggccagcgaagagctgatcgaacagatccagtcgatcgaaggcgaatacgtcttc
gaaacctacatctcgctctcctgccagaactgccccgacgtggtccaggcgctcaacctg
atggcagtgctcaacccgaacatccgccacaccatgatcgacggcgcgctgttccaggat
gaggtggagaagcgccagatcatggcggtgccgaccgtgttcctcaacggcgagaacttc
ggccagggccggatgaccgtcgaggagatcgtcggccgcctcgatactggcgccgcggcc
cgcgaggccgagaagctcaatgccaagcaagcctatgacgtactggtggtcggcggcggt
cccgctggcgcggcggcggcgatctacgccgcacgcaagggaattcgcaccggcgtcgcc
gccgagcgcttcggcggccaggtgctcgacaccctggcgatcgagaatttcatttcggtc
aaggagaccgaaggaccgaagctcgccgccgcgctcgaggagcacgtcaagcagtacgac
gtcgagatcatgaacctgcagaccgccgagaagctgatcaccgcgaaggagcaaggcggc
ctgcacgaagtgctgttcgccaacggtgcctcgctcaaggccaagacgctgatcgtcgcc
accggtgcacgctggcgcaagatgaacgtgcccggcgagctcgagtacgccaacaagggc
gtcgcctactgcccgcactgcgatggcccgctgttcaagggcaagccggtcgcggtgatc
ggcggcggcaactcgggagtcgaggcggcgatcgatctcgccggcatcgtctcccacgtc
actctgatcgagttcgacaccgcgcttcgcgccgatgcggtgctccagcgcaagttgatg
agcctgcccaacgtcaccgtgctgaccaacgccctgaccaccgaagtggtcggtgatggc
aacaaggtcagcgggctggtctacaaggaccgcgcgagcggagaagagcgcaccgtcgag
ctggcggggatcttcgtccagatcggcctggtgcccaataccgactggctcaagggttct
atcgagctcagcggccgcggtgaggtgatcatcgacgagcgcggtcagacctcgtctcct
ggggtattcgccgccggcgacgttaccaccgtgccctacaagcagatcgtgatcgcgatg
ggtgaaggcgccaaggcgtcgctctccgccttcgaccacctgatccggatcaccgcaccg
gcctga

DBGET integrated database retrieval system