KEGG   Halotalea alkalilenta: A5892_07555Help
Entry
A5892_07555       CDS       T04333                                 

Definition
(GenBank) microcin ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
haa  Halotalea alkalilenta
Pathway
haa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:haa00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A5892_07555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:haa02000]
    A5892_07555
Transporters [BR:haa02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    A5892_07555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 oligo_HPY SMC_N AAA_16 AAA_29 AAA_22 RsgA_GTPase AAA NACHT AAA_33 Mg_chelatase ATP-synt_ab AAA_23 Sigma54_activat APS_kinase Zeta_toxin ABC_ATPase DUF2666 DUF87 NB-ARC DUF2013
Motif
Other DBs
NCBI-ProteinID: ANF57335
UniProt: A0A172YEE2
LinkDB All DBs
Position
1720658..1722355
Genome map
AA seq 565 aa AA seqDB search
MSTATVTSERDSADPAAEKVLEVEGLVVETGGKHPAPILRGVSFSIRPGETLCLVGESGS
GKSVTSLATMGLLPRGALVARAGRILLDGENLLEATPSRLKALRASRMAMIFQEPMTALN
PVLSVGRQLDEVLETHTRLSSRERKAKVLDAFSQVHLPEIERIYSSFPHQLSGGQRQRIM
IAMALVLEPRLLIADEPTTALDVTTQKQILSLIKELQQKHGTAVLFITHDMGVVVDIADR
VCVMNKGEVVESGEVAQVLGAPRETYTQTLLDAVPSLTPRAPRIEASQKTVLEVQALEKV
FEGGRGLMRWLGKSSEGTRAVDDVSFRLKRGRTLGIVGESGSGKSTLARCVMRLETPSGG
AIRVDGKEISELSRSMLKPHRKRIQMIFQDPNRSLNPRRTVGDSLVEGPMNYGTPRKQAW
ARGRELLELVGLPADAIDRYPHQFSGGQRQRIAIARALMMEPEVIVADEAVSALDVSVQA
QVLGLIDEIQQRLGIAVLFITHDLRVAAQICDEVLVMQRGKLVEYGPAAAVLANPQAEYT
RALMEAAPGRHWDFAARAPLQPIAG
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgccacagtgacgtccgaacgcgattctgccgacccggccgcggagaaggtg
ctcgaggtcgaggggctggtggtcgagactggcggcaagcatccggcgccgatccttcgc
ggcgtgtcgttctcgatccgccccggtgagaccctttgcctggtcggcgagtcaggctcg
ggcaagtcggtgacctcgctcgccaccatgggactgctgccgcgcggtgcgctggtggcg
cgagcagggcgcatcctgctcgacggcgagaacctgctcgaggccaccccttcgcggctc
aaggcgctgcgggccagccgcatggcgatgatcttccaggagccgatgaccgcgctgaac
ccggtgctcagcgttggtcgccagctcgatgaagtgctcgagacccacacccggctgtcg
tcgcgtgagcgcaaggccaaggtgctcgacgccttctcccaggtccatctgccggagatc
gagcgcatctattcgagcttcccgcaccagctctcgggcggccagcgccagcggatcatg
atcgcgatggcgctggtgctcgagcctcggctgttgatcgccgacgagccgaccaccgcg
ctcgacgtcaccacgcaaaagcagatcctctccttgatcaaggagctgcagcagaagcac
ggcaccgcggtgctgttcatcacccacgacatgggcgtggtggtcgacatcgcggaccgg
gtctgcgtgatgaacaaaggcgaggtggtcgagagcggcgaggtcgcccaggtgctcggt
gcgcctcgcgagacctatacccagaccctgctcgacgcggtgcctagcctcaccccgcgt
gcgccgcgcatcgaggcgagccagaagaccgtgctcgaagtccaggcgctggagaaggtg
ttcgaaggcggccgcggactgatgcgctggctgggcaagtcgagcgagggcacgcgcgcg
gtggacgatgtcagcttccggctcaagcgcgggcgcacgctcggcatcgtcggggagtcg
ggctcgggcaagtcgacgctcgcgcgctgcgtgatgcgcctcgagacgccgagcggcggc
gcgatccgggtcgatggcaaggaaatctccgaactctcgcgctcgatgctcaagccgcac
cgcaagcggatccagatgatcttccaggaccccaatcgctcgctcaacccgcgccgcacc
gtcggcgacagcctggtcgaggggccgatgaactacggcacgccgcgcaagcaggcgtgg
gcgcgcgggcgcgagctgctcgaactggtgggcctgccggcggatgcgatcgatcgctac
ccgcaccagttctccggaggccagcgtcagcgtatcgcgatcgcacgtgcgctgatgatg
gagcccgaggtgatcgtcgccgacgaggcggtatcggcgctcgacgtctcggtgcaggcg
caggtgctggggctgatcgatgagatccagcagcgcctcgggatcgcggtgctgttcatc
acccacgatctcagggtggcggcgcagatctgcgacgaggtgctggtgatgcagcgaggc
aagctggtggagtacggtccggcggcggcggtactggccaacccccaggccgagtacacc
cgcgcgctgatggaggcggccccgggacggcattgggacttcgccgcccgtgcaccgttg
caaccgatcgctggatga

DBGET integrated database retrieval system