KEGG   Halotalea alkalilenta: A5892_13995Help
Entry
A5892_13995       CDS       T04333                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
haa  Halotalea alkalilenta
Brite
KEGG Orthology (KO) [BR:haa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:haa03016]
    A5892_13995
Enzymes [BR:haa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     A5892_13995
Transfer RNA biogenesis [BR:haa03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    A5892_13995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2 EPL1 Arm-DNA-bind_3
Motif
Other DBs
NCBI-ProteinID: ANF58443
UniProt: A0A172YGT7
LinkDB All DBs
Position
3134422..3136365
Genome map
AA seq 647 aa AA seqDB search
MLSNNPLLAQLKQQLHAETPRVTGVVKATDKGFGFLEAEDGQSYFVPPPMMKKVVHGDRV
EAVVHVQGEKKSVEPETLVEPSLERFIGRVRRREGRLGVVPDHPSINLALNARAKRGIDE
AGLEEGDWVVARLLRHPLRPDDRSFLVQIEELISRHDQPNVPWRVTLARHVLEYASPVDG
SECSLRDEGLEREDLTALPFFTIDSRTTRDMDDALHIEAREEGGWRLRVAIADPTAFVAE
DDAVDQEARRRAFTVYLPGQNVTMLPERLADDLCSLRENETRAALACTLEVAADGELLDY
RFYAAEVRSHAQLAYDDVSDWIEGKGEWKPVFPRGEEQLRQLADFTEARSAWRSRNAIVF
KDRPDYAFELDAEGRVLAVRTEPRRIANRMVEESMIAANVCCARLLGEEVGHGIFNVHLG
FAAEKLDHALAFLAEQSIEASREQLTDLDAWRALRYQLDERDDAWLEARLRRFQGYTAMT
AAPGPHFGMGLPAYATWTSPIRKYGDMINHRLIKALLLAQARPASASETLTAHLSERRKL
NRMAERDVKDWLYVRHLAPAVGSGQRFEAEIVDIRRGGLRVRLNDNGASVFVPASTLEAD
REALVIDDKEGVVSVRGEQRYRLGDIIEVVLSEAREETRSLIGRPVS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgctctcgaacaaccctctcctcgctcagctgaagcagcagctccatgccgagacgccc
cgcgttaccggtgtcgtcaaggccaccgacaaaggcttcggctttctcgaggccgaggac
ggacagtcctacttcgtccccccgccgatgatgaagaaggtggtccacggcgaccgtgtc
gaagcggtcgtccatgtccagggcgagaagaagagcgtcgagccggaaaccctggtcgag
ccctcgctcgagcgcttcatcggccgggtgcgtcgccgcgaaggccgtctcggcgtggtg
ccggaccatccatcgatcaatctcgcgctcaatgcccgcgccaagcgcggcatcgacgag
gcggggctagaggaaggcgactgggtggtggcgaggctgctgcgccacccgctgcgcccc
gacgatcgttcgtttctggtccagatcgaggaattgatcagccgtcacgaccagcctaac
gtaccgtggcgcgtgacgctggcacggcatgtgctggagtacgcctctccggtcgatggg
tcggagtgcagcctgcgcgatgaaggactcgagcgtgaggacctcaccgctctgccgttt
ttcaccatcgacagccgcaccacccgcgacatggacgacgcgctgcacatcgaggcacgc
gaggaaggcggctggcgcctgcgggtcgcgatcgccgacccgaccgcattcgtcgccgag
gatgacgcggtggaccaggaggcccggcggcgcgccttcaccgtctacctgccgggacag
aacgtcaccatgctgcccgagcggctcgccgacgatctctgctcgctgcgcgagaacgag
actcgcgcggcgctggcctgcaccctagaggtcgcggccgacggtgaactgctcgattac
cgtttctacgctgccgaagtgcgctcccacgcccagctcgcctatgacgatgtctccgat
tggatcgagggcaagggcgaatggaagcccgtcttcccccgtggtgaagagcagctgcgc
cagctcgcagacttcaccgaggcgcgcagtgcctggcggtcacgcaacgcgatcgtgttc
aaggatcgccccgactacgccttcgagctcgacgccgagggccgcgtactggcggtgcgc
acggagccgcggcggatcgccaaccgcatggtcgaggagtcgatgatcgccgccaacgtc
tgctgcgcgaggctgctcggcgaagaagtcggccatggcatcttcaacgttcatctcggc
ttcgccgcggagaagctcgaccatgcgctggccttcctcgccgagcagtcgatcgaggcg
agccgcgaacagctcaccgatctcgacgcttggcgtgcgctgcgctaccagctcgacgaa
cgcgacgacgcttggctcgaggcacggctgcgccgcttccagggctacactgcgatgacc
gcggcaccgggcccgcatttcggtatgggactgcccgcctatgccacctggacctcgccg
atccgcaaatacggcgacatgatcaaccaccggttgatcaaggcgctgctgctcgcgcag
gcacggcccgcaagcgccagcgagacgctcaccgctcatctctccgagcggcgcaagctc
aaccgcatggccgagcgcgacgtcaaggactggctctacgtgcgccatctggcgcccgcg
gtgggcagtggccagcgcttcgaggccgagatcgtcgacatccgccgcggcggcttgcgg
gtacggctgaacgacaacggcgcttcggtgttcgtccccgcctcgaccctcgaggccgac
cgtgaagcgctggtgatcgacgacaaggaaggcgtggtctctgtgcgcggcgaacagcgc
tatcgcctcggcgacatcatcgaggtagtgctcagcgaagcccgcgaagaaacccgttcg
ctaatcggtcgccccgtctcctga

DBGET integrated database retrieval system