KEGG   Halotalea alkalilenta: A5892_18250Help
Entry
A5892_18250       CDS       T04333                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
haa  Halotalea alkalilenta
Pathway
haa00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:haa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A5892_18250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:haa01002]
    A5892_18250
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:haa01011]
    A5892_18250
Enzymes [BR:haa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A5892_18250
   3.4.21  Serine endopeptidases
    3.4.21.-  
     A5892_18250
Peptidases and inhibitors [BR:haa01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   A5892_18250
Peptidoglycan biosynthesis and degradation proteins [BR:haa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   A5892_18250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ANF59767
UniProt: A0A172YKL3
LinkDB All DBs
Position
complement(4082419..4083843)
Genome map
AA seq 474 aa AA seqDB search
MAPLLLLGLSFGTPALVQAAGLPTLQALADGRFDISAEVRMLDDGRVLGELDPRRSLAPA
SLSKLYIAAAALGRYGPQHRFVTRLVSDGEQRGATLHGDLVLDSGGDPAMTTERYWTLVE
QLAARGIERIDGRVRLAQWQFGPEPCGVADRCSARDATMSSYDARLSPVAVDYAAWCVRL
LPTRPGAPALVGGCFSSRPLVAVSGEVNTVAEGQPTRLNARRTTANGRDTLTLSGQVSVA
DGPQSVYRSASDPAQQTLATLEMLFAQSGIRVARGFAIDATPPPAGARELAAVESPPLQM
ALMDMLNYSNNFMADVLTIGLSASQPPSLASGAAALERFVDTVPGHGPVSLASGSGLTPD
SRTSAHGLVALLDAMYRRAELFPTFVSAMQTPGNGAARFIRRGDPLFQRSVMIKTGTLNQ
PVPVRAIAGYFRTSSGRWGAFAVMLNGRAATPYLVWPDVLQALSSDLTPLIERY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
ttggcccccttgctgctgctcggcctttctttcggtacgcctgcgctggtccaagccgcg
ggactgccgacgctccaggcgttggccgacggccgcttcgacatcagtgccgaggtgcgc
atgctcgacgacggccgcgtgctcggcgagctcgacccgcgacgctcgcttgccccggct
tctctctccaagctctacatcgccgccgcggcgctcggccgctacgggccgcagcatcgc
ttcgtcactcgactggtcagcgacggcgagcagcgcggcgctacgctgcatggcgatctg
gtcctcgacagcggtggggatccggcgatgaccaccgagcgctactggactctggtcgag
cagctggccgcgcgcggtatcgagcgcatcgacggccgggtgcggctcgcccagtggcag
ttcggccccgagccgtgcggggtggcggatcgctgcagcgcgcgtgatgcgacgatgagc
tcctacgatgcacggctctccccggtggcggtcgactatgcggcctggtgcgtgcggctg
ctgccgacgcgtcccggggcgcctgctctggtcggcggctgtttcagctcgcggccgctg
gtcgcggtgagcggtgaggtaaacaccgtcgccgagggccagccgacccggctcaacgcg
cggcgcaccaccgctaacggtcgcgacaccctgacgctttcggggcaggtctcggtcgcc
gacgggccgcagtcggtctaccgctcggcctccgatcccgcccagcagaccctggcgacg
ctcgagatgctgttcgcccagagtgggatccgcgtggcaaggggcttcgccatcgatgcg
accccgccgccggcgggcgcccgcgagctcgccgcggtcgagagtccgccgctgcagatg
gcgttgatggacatgctcaactactcgaacaacttcatggccgacgtgctcaccatcggg
ctctccgccagccagccaccgagcctggccagcggagccgcggcactcgagcggttcgtc
gacacggtccctggtcatggtccggtgagtctcgccagcggcagcgggctgacgccggac
agccgcaccagcgcccacgggctggttgcgctgctcgacgcgatgtaccggcgcgccgag
ctgttcccgaccttcgtcagcgcgatgcagactcccggcaacggcgcagcgaggttcatt
cgtcgcggcgatccattgttccagcgcagcgtgatgatcaagaccggcacgctcaaccag
ccggtgccggtgcgtgcgatcgcgggttactttcgcacctcatccgggcgctggggcgct
ttcgcggtgatgctcaacggtcgtgcggcgaccccctacctggtctggcccgatgtgctc
caggcgctctccagcgatctcaccccgctgatcgagagatactga

DBGET integrated database retrieval system