KEGG   Haloarcula sp. CBA1115: SG26_04860Help
Entry
SG26_04860        CDS       T03645                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hab  Haloarcula sp. CBA1115
Pathway
hab00564  Glycerophospholipid metabolism
hab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SG26_04860
Enzymes [BR:hab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SG26_04860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 FAD_binding_2 Pyr_redox_2 Pyr_redox FAD_oxidored Thi4 Lycopene_cycl NAD_binding_7 NAD_binding_8 GIDA 3HCDH_N HI0933_like Pyr_redox_3 ApbA PALP Amino_oxidase TrkA_N
Motif
Other DBs
NCBI-ProteinID: AJF25099
UniProt: A0A0B5GXS4
LinkDB All DBs
Position
997937..999160
Genome map
AA seq 407 aa AA seqDB search
MAIETDVLVVGGGATGAGVARDLALRGIDVTLVERDGLTSGTSGRSHGLLHSGARYAEAD
RVGAEECITENRILKEIAGACIRDTGGLFVQLAGDDPDYFEAKRAACEDIGIPVETLDSD
AAQERVPDLAAEVERAFEVPDAVIYPSRLVAANAADAREHGADIHPHAPVEDVLVADGQV
TGVRVGGAVGDTIEADYVVNATGAWAGEFAAMADLDVEMQPTRGVMVSVEYDDLGPVLNR
CRDPDDGDIVVPHEREAVLGTTSVPVRDPDEYETEQWEIEESIEECAAMLPPVADAPEVR
TWWGVRPLYAPDEDERGGRGISRGFFLLDHADDGVDNMASIVGGKLTTYRQMAEATADLV
CDGIGVDADCRTADRRLPSVDDPAQLDALVAEFDGQGPTDEDVVGSV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgagacggatgtcctcgtcgtcggtggtggcgcgaccggcgctggcgtcgct
cgtgacctcgcactccgtggcatcgacgtgacgcttgtcgagcgtgacgggctgacaagc
ggtacctccggacgttcgcacgggttgctgcacagcggtgcccgctacgccgaggcagac
cgggtcggtgccgaggagtgcatcaccgaaaaccggatactcaaagaaatcgccggggcc
tgcatccgcgacaccgggggcctgttcgtccaacttgccggggacgaccccgactacttc
gaggccaaacgggcggcctgtgaagacatcggcatccccgtcgagacgctggacagcgat
gcagcccaagagcgggttcccgacctcgccgcggaggtcgagcgcgcgttcgaagtcccg
gacgccgtcatctacccgtcccggctcgtcgccgcgaacgccgcagacgcccgcgaacac
ggcgcggacattcacccacacgcgcccgttgaagacgtgctcgtggcggacgggcaggta
accggcgtgcgggtcggcggggcggtcggcgataccatcgaggccgactacgtcgtcaac
gcgaccggtgcctgggcgggcgagttcgctgcgatggccgacctcgacgtcgagatgcaa
ccgacgcggggcgtgatggtctccgtcgagtacgacgacctcgggccggtactcaaccgc
tgccgggaccccgacgacggcgacatcgtcgtgccacacgagcgcgaggccgtcctcggg
acgacgagcgtgccggtccgcgacccggacgagtacgagacggagcagtgggaaatcgaa
gagagcatcgaagagtgtgcggcgatgctgccgccagttgcagacgcccccgaggtccgg
acctggtggggcgtccggccgttgtacgccccagacgaggacgagcgcggcggccgcggc
atctcgcgtggcttcttcctgctcgaccatgctgacgacggcgtcgacaacatggcgagc
atcgtcggcggtaaactgaccacctaccggcagatggccgaggcgacggccgacctcgtc
tgtgacggcatcggcgtcgatgcggactgtcggactgcggaccgaaggctcccgagcgtc
gacgacccggcgcagttggacgcgctcgtggccgagttcgacggtcagggaccgaccgac
gaggacgtggtcgggtcggtgtga

DBGET integrated database retrieval system