KEGG   Haloarcula sp. CBA1115: SG26_17390Help
Entry
SG26_17390        CDS       T03645                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
hab  Haloarcula sp. CBA1115
Pathway
hab00040  Pentose and glucuronate interconversions
hab00051  Fructose and mannose metabolism
hab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SG26_17390
   00051 Fructose and mannose metabolism
    SG26_17390
Enzymes [BR:hab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SG26_17390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AJF27548
UniProt: A0A0B5H109
LinkDB All DBs
Position
unnamed1:82030..83061
Genome map
AA seq 343 aa AA seqDB search
MRTAVLVEPNEFELKDRPRPSPGPDDVLVAVRDVGICGSDVHYYEHGRIGDYVVEDPLVL
GHESAGEVVEVGENVTHHEPGDRVALEPGVPCRRCAHCKRGDYHLCEEVTFMATPPHDGA
FTEYVSWPADFAYTLPEAVSTAEGALCEPLSVGIHACRRGSVGTGDTVLITGAGPIGLMV
LEAARAAGATDVILTDVVDEKLTFAEERGADLTVNVTETDLDAAVAEYTDGVGADVVVEA
SGAEPSIKSTIDVVRRGGTVVLVGLASEAEVPIDVLELIDNEVDVHGSFRYKNTYDAAVD
LLADGEVDVEGIIDFESELEDIDDAFRRAMEPTVVKGMISLDS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgaactgctgtactggtagaaccaaatgagttcgagctgaaggaccgtcccagaccg
tcgcccgggcccgacgacgttcttgttgccgtgcgcgacgtgggtatctgtggctccgac
gtccactactacgaacacggtcgtatcggcgactacgtcgtcgaagacccgctcgtcctc
ggacacgagagcgccggtgaagtcgtcgaagtgggcgagaacgttacgcaccacgaaccg
ggcgaccgggtcgcgctcgaacccggtgttccgtgccggcgctgtgcccactgcaagcgc
ggcgactaccacctctgtgaggaagtgacgttcatggcgacgccgccacacgacggcgcg
ttcacggagtacgtctcgtggccggccgacttcgcctacacgctcccggaggccgtttcc
actgctgaaggggcactgtgcgagccgctttcggtcggcatccacgcctgccgccgcggc
agcgtcggaaccggggatacagtgctgataaccggcgccgggccgattgggctgatggtg
ctggaggccgcgcgtgccgcgggcgcgacggacgtaatactgaccgatgtcgtcgacgaa
aagctgaccttcgccgaagaacggggagcggacctgaccgtcaacgttaccgaaacggat
ctcgatgcggcggtcgccgagtacacggacggcgtcggtgctgatgtggtcgtcgaagcc
tccggcgcggagccgtcgatcaagtcgacaatcgacgtggtccgtcggggcggcacggtc
gttctggtcggactcgccagcgaagcggaggtcccaatcgacgtgctggaactcatcgac
aacgaggtcgacgtccacggctcgttccggtacaagaacacctatgacgcggctgtcgac
ctgttggccgacggcgaagtcgacgttgagggaatcatcgacttcgaatccgaactcgaa
gatatcgacgacgcgttccgccgagcgatggagccgactgtggtcaagggcatgatatca
cttgattcgtaa

DBGET integrated database retrieval system