KEGG   Helicobacter acinonychis: Hac_0455Help
Entry
Hac_0455          CDS       T00371                                 

Gene name
serA
Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
hac  Helicobacter acinonychis
Pathway
hac00260  Glycine, serine and threonine metabolism
hac00270  Cysteine and methionine metabolism
hac00680  Methane metabolism
hac01100  Metabolic pathways
hac01120  Microbial metabolism in diverse environments
hac01130  Biosynthesis of antibiotics
hac01200  Carbon metabolism
hac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hac00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Hac_0455 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hac_0455 (serA)
   00270 Cysteine and methionine metabolism
    Hac_0455 (serA)
Enzymes [BR:hac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Hac_0455 (serA)
    1.1.1.399  2-oxoglutarate reductase
     Hac_0455 (serA)
Exosome [BR:hac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hac_0455 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: CAJ99286
UniProt: Q17YJ0
LinkDB All DBs
Position
complement(402098..403672)
Genome map
AA seq 524 aa AA seqDB search
MYQVAICDPIHAKGIQILEAQKDIVLHDYSKCSKNELLEKLIPMDALITRSMTPITSDFL
KPLTHLKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRLFPCA
NDQIKHQRLWKREDWYGTELKNKKLGIIGFGNIGSRVGIRAKAFEMEVLAYDPYIPSSKA
TDLGVIYTKNFEDILQCDMITIHTPKNKETINMIGTKEIERMKKGVILINCARGGLYSED
ALYEALETKKVRWLGIDVFSKEPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGV
MESLRGSSHPHALNLPMQAFDASTKAYLNLAQKLGYFSSQIHKSVCQKIDFSLCGEINQF
KDALVAFMLVGVLKPIVGDKINYINAPFVAKERGIEIKVSLKESALPYKNMLSLTLNATN
GAISVSGTVFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNVFARHGINIA
DFRLGRNTQKEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaagtagccatttgcgaccccatccatgccaaaggcattcaaattttagaagct
caaaaagatattgttttgcatgattattccaaatgctctaaaaatgagcttttagaaaaa
ctcattcctatggatgcactcatcactcgtagcatgacccctatcacaagcgatttttta
aagcctctaacccatttaaaatccattgtaagagcgggtgtaggagtggataatattgat
ttagaaagttgctctcaaaaaggcattgtagtgatgaatatccctaccgctaacacgatc
gccgctgtggaattgaccatggcgcatttaattaatgcggtgcgattgtttccttgtgcg
aatgatcaaatcaaacaccaaaggctatggaagagagaagattggtatggaacggaattg
aaaaataaaaagctaggcattattggttttgggaatattggctctagggtgggcattaga
gcaaaagcgtttgaaatggaagttctagcctatgacccttatatcccttcttcaaaagcc
actgatttaggagtcatttacacaaaaaattttgaagatattttacaatgcgacatgatc
actatccacacccctaaaaataaagaaaccattaacatgataggcactaaagagattgaa
cgcatgaaaaaaggggttatcttgatcaattgcgctaggggtgggctttatagtgaagac
gctctttatgaagctttagaaactaaaaaagtgcgttggcttggcattgatgttttttct
aaagagccaggtattcataacaagcttttagacttgcctaatgtttatgcgaccccccat
attggtgcaaacactttagaatcccaagaagaaatttccaagcaagccgcccaaggggtt
atggaatctttaaggggttcaagccatccgcatgccctaaatttacccatgcaagctttt
gatgccagcactaaagcctacttgaatttagctcaaaaactaggttatttttccagtcaa
atccataagagcgtgtgccaaaagattgattttagtctttgtggagagatcaatcaattt
aaagacgctcttgttgctttcatgttagtgggggtattaaaacccattgtaggggataaa
atcaattacattaacgccccctttgtagccaaagaaagaggcattgaaatcaaggttagc
cttaaagaaagtgctttaccttataaaaacatgctctctttaaccctaaatgcaactaat
ggtgcgatcagcgtgagcggcacggtgtttgaagaggatattttaaaactcactgagatt
gatgggtttcatattgatatagagccaaagggcaaaatgcttttatttaggaatacggat
attccaggcgttatcggaagcgtggggaatgtatttgctagacatggcattaatatcgct
gactttcgtttggggcgcaacacgcaaaaagaagccctagcgctcattattgtagatgaa
gaggtttctttggaagttttagaagagcttaaaaacattcctgcgtgtttaagcgttcat
tatgtggttatttaa

DBGET integrated database retrieval system