KEGG   Helicobacter acinonychis: Hac_0681Help
Entry
Hac_0681          CDS       T00371                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hac  Helicobacter acinonychis
Pathway
hac00473  D-Alanine metabolism
hac00550  Peptidoglycan biosynthesis
hac01100  Metabolic pathways
hac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Hac_0681 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hac_0681 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Hac_0681 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hac01011]
    Hac_0681 (ddlA)
Enzymes [BR:hac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Hac_0681 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:hac01011]
 Precursor biosynthesis
  Amino acid ligase
   Hac_0681 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK VitD-bind_III ATPgrasp_TupA
Motif
Other DBs
NCBI-ProteinID: CAJ99485
UniProt: Q17XZ1
LinkDB All DBs
Position
complement(596866..597918)
Genome map
AA seq 350 aa AA seqDB search
MVEFCVLFGGASFEHEISIVSAIALKEVLKDQIKYFIFLDENHHFYLIEASNMHSKYFAQ
IKEKKLPPLMLTHNGLLKNSFLGAKTIELPLMINLVHGGDGEDGKLASLLEFYRIAFIGS
RVEASVLSYNKHLTKLYAKNLGVKTLDCILLNEKNRANALDLIKPSFNFPFIVKPNNAGS
SLGVSVVKEEKELAYALDGAFEYSKEVLIEPFIQRVKEYNLAGCKIKEDFCFSYVEEPNK
QEFLDFKQKYLDFSRTKAPKANIPNALEEQLRENFKKLYNDLFDGAIIRCDFFVIDNEVY
LNEINPIPGSLANYLFDDFKTTLENLAQSLPKTPKIQVKNSYLLQIQKNK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggtggaattttgcgttttatttggtggggcgagttttgaacatgaaatcagtattgtg
agtgcaatcgcacttaaagaagtgttgaaagatcaaattaaatattttatttttttagat
gaaaaccatcatttttacttgattgaagcatctaacatgcattcaaaatacttcgctcaa
atcaaagaaaaaaaattaccccccctaatgctgacacacaatggtttacttaaaaactcg
tttttaggcgctaaaacaatagaattacctttaatgattaaccttgtgcatggaggcgat
ggcgaagacggaaaattagcgagcttgttagaattttatcgtatcgcttttataggctct
agagttgaagcgagcgtgttgagctataacaaacatttaaccaagctttatgctaaaaat
ttaggggtaaagactttagattgcattcttttgaatgaaaaaaaccgtgctaacgccctg
gatttgatcaagcctagttttaattttccctttattgtcaaacccaataacgctgggagc
tctttaggggtgagtgttgtgaaagaagaaaaagaattagcctacgctttagatggcgcg
tttgaatattctaaagaagtcttaatagaacctttcattcaaagagtgaaagaatacaat
ttagccggttgtaagataaaagaggatttttgtttttcctatgttgaagagcctaacaaa
caagagtttttggatttcaaacaaaaatatttggatttttcacgcaccaaagcccctaaa
gctaacattcctaacgccctagaagaacaattgagagaaaattttaaaaaactctataac
gatttgtttgatggtgcgatcattcgttgcgatttttttgtcatagataacgaagtgtat
cttaatgagatcaaccccattcctggcagtttagccaattatttgtttgatgattttaaa
acaacgctagaaaatttagcccaatcattacccaaaacccctaaaatccaagttaaaaac
tcttatttgttacagatccaaaagaataagtaa

DBGET integrated database retrieval system