KEGG   Helicobacter acinonychis: Hac_1313Help
Entry
Hac_1313          CDS       T00371                                 

Definition
(GenBank) unnamed protein product; (Q9ZKQ9) Alanine racemase (EC 5.1.1.1); High confidence in function and specificity
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hac  Helicobacter acinonychis
Pathway
hac00473  D-Alanine metabolism
hac01100  Metabolic pathways
hac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Hac_1313
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Hac_1313
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hac01011]
    Hac_1313
Enzymes [BR:hac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Hac_1313
Peptidoglycan biosynthesis and degradation proteins [BR:hac01011]
 Precursor biosynthesis
  Racemase
   Hac_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C PmrD
Motif
Other DBs
NCBI-ProteinID: CAK00052
UniProt: Q17WC4
LinkDB All DBs
Position
1131544..1132677
Genome map
AA seq 377 aa AA seqDB search
MLRRASFVEVDTSSLRHNFHAAKNAIPKDAHIMAVVKANAYGVGALKASEVFLQEGAHYL
GVATLDEALELRSCFPKTPILILGYSPNSNAQMLIDNNLTAMIFSLEQAGVFSQAALKSQ
KHLKVHLKIDTGMHRLGLEPNFKSIEMIKKIRALNGLEVEGIFTHLSNANANIKTHAKNQ
MKIFNAFLEQLLDQKIEFQYRHAYNSAGILSLCNNNENRFLNLYRPGIMLYGFYPSNEMK
QSCQTILNNVVSLKAKIVQIKRVKKGEFVGYGKHFYTNEETLIGTLALGYADGLVRDLGN
RIQVAINNQLAPLIGKVCMDQCFVKLDGIEAKEGDEVILFGDKSTKANDANEIAMLLNTI
PYETISTLSKRLERVYV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaagggcgagttttgtagaagtggatacttcttctttaaggcataattttcat
gcagccaaaaacgctatccctaaggacgcccatatcatggcggttgtcaaggcgaacgct
tatggggtgggggcgcttaaggcaagtgaagtctttttgcaagagggggcgcattattta
ggggtagcaactttagatgaagctttagagttgcgttcttgttttcctaaaacccccatt
ttgattttaggttatagccctaattctaacgctcaaatgctgattgataataatttgacc
gccatgatttttagccttgagcaagcgggagttttttctcaagcggctttaaaatctcaa
aaacacttaaaagtgcatcttaagatcgatactgggatgcaccgcttgggtttagagcct
aattttaaaagcatagaaatgataaaaaaaatccgcgctttaaatggcttggaagtggag
gggatcttcacgcatttaagcaacgctaatgccaatatcaaaacccatgctaaaaaccaa
atgaaaatttttaacgcttttttagaacagcttttggatcaaaaaatagagtttcaatac
cgccatgcctataattccgccggcatcctttctttgtgcaacaacaatgaaaatcgcttt
ttaaacctttatcgcccagggatcatgctctatggcttctacccctctaacgaaatgaag
caatcatgccaaacaatcttaaacaatgttgtcagcttgaaagctaaaatcgttcaaatc
aaacgcgtcaaaaaaggcgaatttgttggctatggcaagcatttttacacgaatgaagag
actttaattggcactctggcactagggtatgcggatgggttggtgcgcgatttgggcaat
cgcattcaagtcgccatcaataatcaactagcccccttgattggtaaagtgtgcatggat
caatgctttgttaagcttgatggtattgaagctaaagagggcgatgaggtcattttattt
ggggataaaagcaccaaggctaacgacgctaatgaaatcgccatgcttttaaacaccatc
ccttatgaaaccatcagcaccctatccaaacgcttggagcgcgtttatgtgtga

DBGET integrated database retrieval system