KEGG   Helicobacter apodemus: CDV25_01620Help
Entry
CDV25_01620       CDS       T05516                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
had  Helicobacter apodemus
Pathway
had00564  Glycerophospholipid metabolism
had01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:had00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CDV25_01620
Enzymes [BR:had01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CDV25_01620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_3 HI0933_like GIDA FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_binding_3 Thi4 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AWI33602
UniProt: A0A2U8FBJ2
LinkDB All DBs
Position
331687..333249
Genome map
AA seq 520 aa AA seqDB search
MKRLEQILKIKKEQLWNVIIIGGGATGLGIAVDCATRGYKTLLLERSDFTKSTSSRSTKL
LHGGVRYLAQGNISLVYEALHERSLLIRNAPHLCKPQAFVIPTTSIFSAFYYTIGLSIYD
YMAGRLSLGKTRYLNREEVRKSLSGIKDLKMQAGVCYYDGQFDDARLGLSLARTAVENQA
CLINYMRVNQLLKNKEGKICGVEIEDVLEPSFKQQIYSQCVINATGVFSNEINQMDKDDS
LSLVVSQGIHLVFDAKILPNDNALMVPKTSDGRVLFAIPWHHKLIVGTTDTQIQNVAYEP
LPLEEEIDFLLKTLNEYTTRKVNREDILSIFVGLRPLIKQKNKASKNVSRSHKIHISESQ
LISINGGKWTTYRKMAEETIDFAIAKKLLPYQPCITKELPLYGYLNNGDFKDRLCVYGSD
YRAILELEQKEAQLAQKIHPNYPYTYAQVLWALEYEMAETLEDVLSRRIRLLFLDAKASN
EIAKEVGIFIGKYKNWSKKRLEKEIEDFKNLTKQYCIKGV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttagagcagattctaaagatcaaaaaagaacaattatggaatgttattatc
attggaggaggggcaacagggttgggtatagcggttgattgcgcaactcgtggctataaa
actttgttattagagagatctgattttacaaaatcgacttctagtcgctctacaaaatta
ttacatgggggtgtaagatatcttgctcaaggcaatatttctttagtttatgaagcactg
cacgagagaagtctattaatacgcaatgcgccacatttatgcaaaccacaagcttttgtt
atccctactacaagtatttttagtgctttttattatactataggacttagtatctatgat
tatatggcaggaagattaagcttaggcaaaacgcgctacctcaatagagaagaagttaga
aagagtttaagtgggataaaagacttaaaaatgcaagcgggagtttgttattacgatggg
cagtttgatgatgctagattgggtttgagtctagctagaactgcggttgaaaatcaagct
tgtttgataaattatatgcgagttaatcaattattgaaaaataaagagggaaaaatttgt
ggtgttgagattgaggatgttttagagccttcttttaagcaacaaatctattctcaatgt
gttattaatgcaactggagtttttagtaatgagattaatcaaatggataaagatgatagc
ttaagtctcgtggtaagccaaggaatccatttggtgtttgatgcgaagattttacctaat
gataatgctttgatggtcccaaaaacttctgatgggagggtattgtttgctattccgtgg
catcataaattaattgttggaacaacagatacccaaatccaaaatgttgcctatgaacct
ctgcctttagaagaagagatagattttcttttaaaaacacttaatgaatacactactaga
aaagttaatagagaagatattttgtctatttttgttggcttacgtccattgataaaacaa
aagaataaagctagtaagaatgtgtcaagaagccataaaatccacatttctgaaagtcaa
ttaatctctattaatggtggtaaatggacgacttatagaaaaatggcagaagaaacgata
gattttgctattgcaaagaaattattaccttatcaaccttgcataactaaagagcttcct
ttatatggttatttaaataatggagattttaaggatagactctgtgtctatggcagtgat
tatagggctattttagaattagagcaaaaagaagcacaattagcccaaaaaatccacccc
aattatccttatacttatgcgcaagtcttgtgggctttagaatatgaaatggcagaaact
ttagaggatgtattatctcgtagaatccgcttattatttcttgatgcaaaggcttctaat
gaaatagctaaagaggttggaatatttattggtaaatataaaaactggagcaaaaagaga
ttagaaaaagagattgaagatttcaaaaatttaaccaaacaatattgcattaaaggagtt
tag

DBGET integrated database retrieval system