KEGG   Helicobacter apodemus: CDV25_06170Help
Entry
CDV25_06170       CDS       T05516                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
had  Helicobacter apodemus
Pathway
had00970  Aminoacyl-tRNA biosynthesis
had01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:had00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CDV25_06170
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:had03029]
    CDV25_06170
Enzymes [BR:had01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CDV25_06170
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CDV25_06170
Mitochondrial biogenesis [BR:had03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CDV25_06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AWI34389
UniProt: A0A2U8FDU9
LinkDB All DBs
Position
complement(1260275..1261702)
Genome map
AA seq 475 aa AA seqDB search
MSAFETIIGLEVHVQLNTKTKIFCSCPTSFGEEPNKNVCPVCLGLPGALPVLNREVVKKA
IAFGRAINATINQNSIFARKNYFYPDLPKAYQISQYEIPIVGEGSIEIEVNGEKKVIGVT
RAHMEEDAGKNIHEGNCSKVDLNRACTPLLEIVSEPHMRNSDEAIAYLKKLHSIVRFLGI
SDANMQEGSFRCDANVSIRPKGDCKLYTRVEIKNLNSFKFIQKAIEYEVDRQIEAWEDKK
YESEVVQETRLFDTIKGITKSMRGKEEAADYQYFPDPDLLPVFIDDTLMQEGSQIPEMPD
EKRERYIRDFGIKSSDAAVLTSELEMALYFESMLEYGASAKGAVAWLTTELLGRLKGENT
LQNCGIDSKTLSVLVQRIDEGKISGKSAKEILDKLVEDKGGDVDALIDSMGLAQVNDDSA
LLVAVETILGANADKVAEYKNGKDKLFGFFVGQVMKVVKGANPARVNELLKEKLS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttttgaaactattattgggcttgaagtgcatgttcagcttaataccaaaaca
aagattttttgttcttgtcctacaagctttggtgaagagccaaacaaaaatgtttgtcct
gtttgtttagggctacctggtgctttgcctgtgttaaatcgtgaagttgtgaaaaaggct
attgcttttggtagagccattaatgccaccattaatcaaaattctatttttgcaagaaaa
aattatttttatcctgatttacccaaagcttaccaaattagtcaatatgagattcctatt
gtgggagaggggagtattgagattgaagttaatggtgagaaaaaagttattggtgtaaca
agggcacatatggaagaagatgctggaaagaatatccacgaggggaattgctctaaagtt
gatttaaatcgtgcttgcacccctttgctagagattgtcagtgagcctcatatgcgaaat
agcgatgaagccattgcttaccttaagaaattgcattctattgtgcgatttttaggtatt
agtgatgcgaatatgcaagagggaagtttccgttgtgatgcgaatgtttctatccgccca
aagggggattgtaagctttatacacgtgtagagattaaaaatctcaattcttttaagttt
atccaaaaggctattgaatatgaagtggatcgtcaaatagaggcgtgggaggataagaaa
tacgaaagtgaggtcgtgcaagaaacgagactttttgatactattaaaggtattacgaaa
tctatgcgtggtaaagaagaagctgcggattatcagtattttccagatccggatttatta
ccggtatttatcgatgatacgcttatgcaagaaggctcacaaatcccagaaatgcctgat
gagaaaagggagagatatataagggattttggcattaaatctagtgatgctgcagtgctt
actagtgaattagaaatggcattatattttgaatctatgttagagtatggtgcgagtgca
aaaggggcagttgcttggcttactacagagcttttagggcgattaaagggagagaatact
ttacaaaattgtgggatagattctaaaacccttagtgttttagtccaacgtattgatgag
ggtaaaattagtggcaaaagcgctaaagagattttagataaattagtcgaagataaaggt
ggtgatgttgatgcccttatagattctatgggattagcacaagttaatgacgatagtgct
ttattggttgctgttgaaactatccttggtgcaaatgcggataaagttgcagaatataaa
aatggcaaagataagctttttgggttttttgtagggcaggttatgaaagttgttaaaggg
gctaatcccgcacgcgttaatgagcttttaaaagaaaaattaagctaa

DBGET integrated database retrieval system