KEGG   Halohasta litchfieldiae: halTADL_0401Help
Entry
halTADL_0401      CDS       T05239                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hae  Halohasta litchfieldiae
Pathway
hae00620  Pyruvate metabolism
hae00680  Methane metabolism
hae00720  Carbon fixation pathways in prokaryotes
hae01100  Metabolic pathways
hae01120  Microbial metabolism in diverse environments
hae01200  Carbon metabolism
Module
hae_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    halTADL_0401
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    halTADL_0401
   00680 Methane metabolism
    halTADL_0401
Enzymes [BR:hae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     halTADL_0401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATW87216
UniProt: A0A2H4PYM9
LinkDB All DBs
Position
385555..388248
Genome map
AA seq 897 aa AA seqDB search
MKLHNRGVRQDVRELGALLGDVLKEQTSTESFETVEELRKNAIAYREGDIDSREELRNTF
EQLSASEEGDVARAFTTYFELINLAEERERVRAVRKGSQAGTLDDSLEDTIEELSEAGAD
SELVKSVLDDVLIEPTFTAHPTEARRGTVKAKLRSIADHLETLDSQSLTDRESNSVWKDI
NAEVTSLWQTRQVRQRPPEPQDEARNIQWYLENTLFDVTGEVYSEFEDVVTDEYPDIDLP
KLFEFRSWAGSDRDGNPYVTVDVTQDTLERQREIVLERYRTLLKELSAVLSQDGDRYPTT
GAFQASLDADFEDFPMITGEAEERYPDEPYRQKLRLMRERLNRISDVRPGGYDEDDQLLE
DLETIDSSLRAYGGSDIAEAFVEPLLRQVSTFGFSLASLDLRDHRIQHTKAIDEALAEEG
IEYRDLDEDERVDLLTNAILQDEPLIDPENPGDVSEVAEKVLTRFAALGDWQNEFGVEAI
DTYCISMTEEPSHVLEVLFLADQVGAVSLPDHAGLDVVPLLETESALNGADRIMGTLFEN
EAYKQVLEARGNTQEIMLGYSDSNKENGFLAANWDLYKNQKRLAEITNDYDVTMRLFHGR
GGSISRGGGPMNKALLALPNETVTGQVKFTEQGEAIAEKYGNERIAERNLEQMLDAQIRA
RHNALNEPVEEVPDEWAEAMNTMAAAARSAYRDLLETDGFVSYFEQATPITVIEDLNLGS
RPASRSDDRSVEDLRAIPWVFSWTQSRCILPGWFSLAAGVEAYLDDGGDMETLQEMYDEW
AFFQTTFDRAALSLTRTDLEIADEYAALADTELREEFQPRIEGEYETAVDLTAEITGRED
LLRRDWLDESLERRNPYVDPLNLLQTHLLSQTHLTEAEERTLRLTVNGIAAGMKNTG
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacaatcggggcgtgcgccaagacgtccgtgaactgggtgcgttgctcggg
gacgtactcaaagaacagacgtcgaccgaatccttcgaaaccgtcgaggagctccggaag
aacgcgattgcctaccgagagggcgatatcgactcccgcgaggagcttcgcaacaccttc
gaacagctgtcggccagcgaggaaggcgacgtggcgcgggcgtttaccacgtacttcgaa
ctcatcaatctcgctgaggagcgcgagcgggtccgcgcagtccgcaaaggttcccaagcg
ggcacgctcgatgacagccttgaagacaccatcgaagagctctcggaggccggagccgac
agcgaactcgtcaaaagcgtcctcgacgacgtgctcatcgagccgacgttcaccgcccac
ccgaccgaggcccgccgcggcacggtcaaagcaaaactccgctcgattgcggaccacctc
gaaacgcttgactcccaatcgctgaccgaccgcgaatccaactcggtctggaaggatatc
aacgccgaagtaacgagtctctggcagacgcgacaggttcgacagcggccgcccgaacca
caggacgaggcccgaaacattcagtggtacctcgaaaacacgctgttcgatgttaccggc
gaggtctactccgagttcgaggacgtcgtcaccgacgagtaccccgacatcgacctaccg
aagctcttcgagttccgctcgtgggccggcagcgaccgagacggcaacccatacgtgacc
gtcgacgtcacccaagacaccctcgaacgccagcgagagatcgtcctcgaacgctaccgc
acgcttctcaaagagctgtctgcggtcctgagtcaggacggcgaccgttatccgacgact
ggggctttccaagcctctctcgatgctgacttcgaagacttcccgatgatcaccggggag
gccgaggaacgctatccggacgagccataccgccagaagctgcggctcatgcgggaacga
ctcaaccgcattagtgacgttcgccccggcggctacgacgaggacgatcaactcctcgaa
gatctcgaaaccatcgattccagccttcgggcctacggcggcagcgacatcgccgaagcc
ttcgtcgaacccctgctccgccaagtcagcaccttcggcttctcactggcgagcctcgat
ctacgggaccaccggattcagcacaccaaggccatcgacgaggcactcgccgaggaaggc
atcgaataccgtgacctcgacgaagacgagcgcgtcgacctcctaactaatgcgatcctg
caggacgagccgctgatcgaccccgagaaccccggcgatgtctccgaagtggccgagaaa
gtgctcacgcggtttgccgcactcggcgactggcaaaacgagttcggcgtcgaagccatc
gacacctactgtatctcgatgaccgaggagccgagccacgtgctcgaagtgctgttcctc
gccgaccaggtcggcgcagtctcgctgccggaccacgccggtctcgatgtggtgccgctg
ctggaaaccgagtcggcgctcaacggtgccgaccggatcatggggacgctgttcgaaaac
gaggcctacaaacaggttctcgaagcccgtggcaacacccaggagatcatgctgggctac
tccgactccaacaaggaaaacggcttcctcgcggccaactgggacctctataagaaccag
aaacgcctcgccgaaatcaccaacgattacgacgtgacgatgcggctgttccacggtcgc
ggtggctctatctcccgcggtggcggcccgatgaacaaggcactgctggcgctgccgaat
gagaccgtcaccggtcaggtcaagttcacagagcagggcgaagcgattgccgagaagtac
ggcaacgaacggatcgccgagcggaatctcgaacagatgctcgacgcccagatccgtgcc
cgccacaacgcactcaacgagccggtcgaagaggtgcccgacgagtgggccgaagcgatg
aacacgatggccgccgcggcgcggtcggcctaccgtgacctgctcgaaactgatggcttc
gtcagctacttcgagcaggccacgcccattacggtcatcgaggatctcaacctcggctcg
cgtccggcctcgcggtcggatgatcgctcggtcgaggacctgcgggcgatcccgtgggtg
ttctcgtggacccagtcgcggtgtattctccccggctggttctcgcttgcggccggcgtc
gaggcctacctcgacgatggcggcgacatggagacgctccaagagatgtacgacgagtgg
gcgttcttccagaccaccttcgaccgggcggcgctgtctttgacccggacagatctcgaa
atcgccgacgagtacgctgcgttggccgacacggaactccgcgaggagttccaaccgcga
atcgaaggtgagtacgagacggccgtcgacctcactgccgagatcactggtcgcgaggac
ctgcttcgccgcgactggctcgacgagagtctcgaacgccggaacccctacgtcgaccca
ctcaacctgctgcagacccacctgctgagtcagacccacctgaccgaagccgaggaacgc
accctccggctcaccgtcaatgggatcgcagccggcatgaaaaacaccggatag

DBGET integrated database retrieval system