KEGG   Halohasta litchfieldiae: halTADL_0416Help
Entry
halTADL_0416      CDS       T05239                                 

Definition
(GenBank) malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+)
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
hae  Halohasta litchfieldiae
Pathway
hae00620  Pyruvate metabolism
hae01100  Metabolic pathways
hae01120  Microbial metabolism in diverse environments
hae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    halTADL_0416
Enzymes [BR:hae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     halTADL_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: ATW87230
UniProt: A0A1H6VUF2
LinkDB All DBs
Position
complement(402014..404266)
Genome map
AA seq 750 aa AA seqDB search
MGLDEDALEYHSTDPPGKIEIATTKPTNTQRDLSLAYSPGVAAPCERIATDVDQVFDYTA
KGNLVGVVSDGSAVLGLGDIGPEASKPVMEGKGVLFKRFADIDVFDIEMDSDDTDAMIQA
IAMMEPTFGGINLEDIAAPNCFEIERRLGDQLDIPVFHDDQHGTAIISGAALLNACEIAD
KELSELDVTFAGAGAAATATARFYVSLGVPRENITMCDVDGILTTERAEAGELNQYTREF
ASDVPEGELAEAMAGVDVFVGLSVGGIVDQEMVRSMAADPIIFAMANPTPEIGYEEAKNA
RDDTVIMATGRSDYPNQVNNVLGFPFIFRGALDVRATEINEEMKVAASEALAELARQDVP
DAVVKAYGDQPLQFGPDYIIPKPLDPRVLFEVTPAVADAAMESGAARRSLDVETYVEALE
ARLGKSREMMRIILNKAQTDPKRVALAEGDDEKMIRAAYQLVDRGIAEPILLGDRDRIEA
ISETLGLDFDPKIIDPSEGDLDAYADRLYDLRKRNGVTRSEAGKLVEDSTYLGSVMVETG
DADALLTGLTHHYPSSLRPPLQVIGTADDADYAAGVYMLTFKNRVVFCADATVNQDPDAD
VLEEVTRHTADLARRFNVEPRAALLSYSNFGSVDNEGTRKPREAARRLREDPTVEFPVDG
EMQADTAVVEDMLSGTYEFAELDEPANVLVFPNLEAGNIGYKLLQRLGDAEAVGPMLVGM
DKPVHVLQRGDEVKDIVNLAGVAVVDAQHE
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgggcttggacgaagacgcgttagagtaccacagtactgacccgcccggaaaaatagag
attgcgacgaccaaaccgaccaacacccagcgggatctctcgctggcgtactcacccggc
gtcgccgcaccctgtgagcgaatcgctaccgacgtcgaccaggtgttcgactataccgcg
aaggggaacttggtgggcgtcgtctcggatgggtcggcagtgttaggtctcggcgacatc
ggccccgaagcctccaagccggtgatggaggggaaaggcgtccttttcaaacggttcgcc
gatatcgacgtcttcgacatcgagatggactcggatgacaccgacgcgatgatccaagcg
attgcgatgatggagccaacgttcggcggcatcaacctcgaagacatcgcggcaccgaac
tgtttcgagatcgaacgtcgactcggcgatcagttggatatccccgtcttccacgacgac
cagcacggcaccgccatcatttcgggcgctgcactactcaacgcctgcgagatcgccgac
aaagagctctcggagctcgacgtcaccttcgccggtgccggtgccgccgcgaccgccacc
gcccggttctacgtttcgctcggcgttccccgagagaatatcacgatgtgcgatgtcgac
gggattctaacgaccgagcgcgcggaggcaggcgaactcaatcagtacacccgcgagttc
gccagcgatgtccccgagggcgagctggcggaggcgatggctggcgtggacgtgttcgtc
ggcctctctgtgggcggcatcgtcgaccaagagatggtccggtcgatggccgccgatccg
atcattttcgcgatggcaaatccgactcccgagatcggctatgaggaggccaagaacgcc
cgcgatgacactgttatcatggcgacaggccgctcggattacccgaatcaggtcaacaac
gtgctggggtttcccttcatcttccgcggcgcactcgacgttcgggccaccgagatcaac
gaggagatgaaagtcgccgccagcgaggcactggccgagttggcccgtcaggacgtcccc
gatgcggtcgtcaaagcctacggcgatcagccactccagttcggccccgactacatcatc
cccaagccgctcgatccacgggtccttttcgaggtgacccccgcggtcgccgatgcggcc
atggagtccggcgcggcccgcaggtcgctcgacgtcgagacctacgtcgaggcacttgag
gctcgtctgggcaaatcccgcgagatgatgcggatcatccttaataaagcccagaccgac
cccaagcgcgtcgcgctggccgagggcgacgacgagaagatgatccgggcggcctaccag
ctcgtcgaccggggaatcgccgagccgatcttgctgggcgaccgcgaccgcatcgaggcg
atcagcgagacgctcgggctcgatttcgaccccaagatcatcgaccccagcgagggcgat
ctcgacgcctacgccgaccgactgtacgacctgcgcaagcgcaacggcgtcacgcgcagc
gaggcgggcaaactcgtcgaggacagcacctacctcggcagcgtgatggtcgagaccggt
gacgccgacgcgctgctcaccggcctgacccatcactacccgtcatcgctgcggccgccg
ctgcaggtgatcgggacggccgacgatgccgactacgctgccggcgtttacatgctcacc
ttcaaaaaccgcgtcgtgttctgcgccgatgctaccgtcaatcaggacccggatgcggac
gtcttagaggaggtgacgcgtcacaccgccgacctcgctcggcggttcaatgtcgagcca
cgggcggcgctgctgtcgtactccaacttcggaagcgtcgacaacgaggggacccgcaaa
ccccgcgaggccgcccgtcgactccgcgaggaccccacagtcgagttccccgtcgacggt
gagatgcaggccgataccgcggttgtcgaggacatgctttcaggaacctacgagttcgcc
gagctggacgagcccgcgaacgttctcgtgtttccgaacctcgaagccggcaacatcggc
tacaaactcctccagcgactgggcgatgcggaggccgtcgggccgatgctcgtcgggatg
gacaaaccggtccacgtcctccagcgcggcgacgaagtcaaagacatcgtgaacttagct
ggcgttgccgttgtcgacgcccaacatgagtag

DBGET integrated database retrieval system