KEGG   Halohasta litchfieldiae: halTADL_2244Help
Entry
halTADL_2244      CDS       T05239                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hae  Halohasta litchfieldiae
Pathway
hae00564  Glycerophospholipid metabolism
hae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    halTADL_2244
Enzymes [BR:hae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     halTADL_2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 FAD_oxidored FAD_binding_3 FAD_binding_2 Pyr_redox Pyr_redox_3 Amino_oxidase NAD_binding_7 HI0933_like NAD_binding_8 Lycopene_cycl PALP GIDA 3HCDH_N Thi4
Motif
Other DBs
NCBI-ProteinID: ATW88991
UniProt: A0A2H4Q3T1
LinkDB All DBs
Position
complement(2157182..2158471)
Genome map
AA seq 429 aa AA seqDB search
MTPGCELMTHQTTVLVIGGGGTGVGTARDLAMRGVDVTLVERSGLAGGTTGRSHGLLHSG
ARYAESDPEGAAECIEENQIIREIAGECIGDSGGIFVQLSEDDPEYFEAKLEGCQEHGIP
AEVIDGDEARDRVPELSEDVVRAMVVPDGVIYPSRLVAANAASAENHGATVLTHAPVEGI
TVSDGAVSSVEIGGEVNETIEADYVINATGAWAGECAALAGVDVEMQPTKGVMVSVDYEG
LEPVINRCRVPDDGDIIIPHQTQVVLGTTSVAVDDPDEFDEEQWEVQKMFEECADMMPAI
EGRDIDRTWWGVRPLYAPDEAGRGSKDSGKGNERGISRGFFLLDHEQDGVENFASVVGGK
LTTYRMMAEATADHVADVLGVEGESTTATEQLPGADDPEELDSLVAKYRARQPTDQDVIS
DLGEQAADD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgactccggggtgtgaactcatgacacaccaaacaaccgtactagtcatcggtggtggc
ggtacaggcgtcggaaccgcacgcgatctcgcgatgcgtggcgtcgacgtcaccctcgta
gagcggagtggtctcgcaggtggcaccactggccgctcccacggcctgctccacagtggc
gcacgctacgccgagtccgaccccgagggcgcagccgaatgtatcgaggaaaaccaaatc
atccgtgagatcgccggagagtgtatcggcgacagcggcggtatcttcgtccaactcagc
gaggacgaccccgagtacttcgaggccaaactcgaaggctgtcaggaacacggcatcccc
gcagaggtcatcgatggcgacgaggcccgcgaccgcgtccccgaactctccgaggacgtc
gtccgcgcaatggtcgttcccgacggcgtaatctatccatcgcggctcgtggcggccaat
gctgccagtgctgaaaaccacggtgcgaccgtcctgacacatgccccagtcgaggggatc
actgtcagcgacggcgcggtttcgagtgtcgagatcggcggcgaggtcaacgagaccatc
gaagccgactacgtcatcaacgcgaccggcgcgtgggccggcgaatgtgccgcactcgct
ggcgtcgacgtcgagatgcagcccaccaagggcgtgatggtcagcgtcgactacgaggga
cttgaaccagtcatcaaccgatgccgggtccccgacgacggcgacatcatcattccccac
cagacgcaggtcgtgctgggcaccacaagcgtggcagtcgacgaccccgacgagttcgat
gaagaacagtgggaggttcaaaagatgttcgaggagtgtgcagacatgatgccggcaatc
gaaggccgcgatattgatcgtacgtggtggggtgtccggccgctgtacgcgcccgacgaa
gcaggtcgcggaagcaaggattcgggcaaaggcaacgagcgcgggatctcgcgcggcttc
ttcctgctcgaccacgagcaagacggcgtcgagaacttcgccagcgtcgtcggcggcaag
ctgacaacctaccgaatgatggccgaggcgacggccgaccacgtcgccgacgtgctggga
gtcgagggagagtccacaaccgcgactgagcagcttccgggtgccgacgaccccgaagaa
ctcgatagcctcgtcgcgaagtacagggcccgccagccgacagatcaggatgtcatcagc
gatctcggcgaacaagccgcagacgactaa

DBGET integrated database retrieval system