KEGG   Haloplanus aerogenes: DU502_13430Help
Entry
DU502_13430       CDS       T05732                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
haer  Haloplanus aerogenes
Pathway
haer00564  Glycerophospholipid metabolism
haer01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:haer00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DU502_13430
Enzymes [BR:haer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DU502_13430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Pyr_redox FAD_binding_2 FAD_binding_3 FAD_oxidored NAD_binding_8 Pyr_redox_3 ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AZH26303
LinkDB All DBs
Position
complement(2609686..2610888)
Genome map
AA seq 400 aa AA seqDB search
MRTTALVIGGGATGVGVARDLALRGVDTTLVERGALAAGTTGRSHGVLHSGARYAETDSD
DAAACLAENRILRDIAPACIEETGGYFLHLDGDDPDYFERKRTACEELGMAVETLSGAAF
RERVPEASPAVERALAVPDAVVSPARLVVANAHAARDAGATLHTHAPVEDIHVDGGEIDR
VDVGGRLDATIRADTVVNATGPWAEECAALAGVSVPMRPTRGVMVAVPNPGVDAVLNRCR
PPADGDIVVPRADEAVLGTTSVAVGDPDDFERTDAEVERTVAECAAMCPGVDAPVRRTYW
GVRPLYAPDEAARGDARAISRDFALLGHRDEGAAGLYTIVGGKLTTYRRMAEATADRVCD
RLGVSAACRTAERPLPGADDPAELDGLLDEFGVDAPADGR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgaccgccctcgtgatcggcggcggcgcgaccggcgtcggcgtcgcccgtgac
ctcgcgctccgcggcgtcgacacgacgctcgtcgaacgcggcgccctcgccgcgggcacc
accggccgctcgcacggcgttctccacagcggcgctcggtacgccgagaccgactccgac
gacgccgcggcctgtctcgccgagaaccggattctccgcgacatcgcccccgcttgcatc
gaggagacgggcggctacttcctccacctcgacggcgacgacccggactacttcgagcgc
aagcggacggcctgcgaggaactggggatggccgtcgagacgctctcgggcgccgcgttc
cgtgagcgcgtgcccgaggcgagtccggcggtcgagcgcgctctcgccgtccccgacgcc
gtcgtctccccggcacgactggtcgtcgccaacgcccacgcggcccgggacgcgggcgcg
acgctccacacccacgcgccggtcgaggacatccacgtcgacggcggcgagatcgaccga
gtcgacgtgggcgggcgcctcgacgcgacgatccgtgccgacaccgtcgtcaacgccacc
ggtccgtgggccgaggagtgtgccgcgctcgccggcgtctcggtgcccatgcgccccacc
cgcggcgtgatggtcgccgttccgaaccccggcgtcgacgccgtgttgaaccggtgtcgc
ccgcccgcggacggcgacatcgtcgttccacgcgccgacgaggcggtcctcggaaccacg
agcgtcgccgtcggcgatccggacgacttcgagcggacggatgcggaagtcgagcgaacg
gtcgcggagtgtgcggcgatgtgtcccggcgtcgacgccccggtccggcgtacctactgg
ggcgtccgcccgctctacgcgccggacgaagcggcgcgaggcgatgcccgcgctatctcg
cgtgacttcgccctgctcggccaccgcgacgagggtgcggccggcctctacaccatcgtc
ggcggcaaactcaccacctaccggcggatggccgaggcgacggccgaccgggtgtgtgat
cgactgggcgtctcggcggcctgtcggacggcggagcggccgcttcccggcgcggacgac
cccgccgaactcgacgggctactcgacgaattcggcgtcgacgcgccggcggacgggcgg
tag

DBGET integrated database retrieval system