KEGG   Halomonas sp. SF2003: C8233_00775Help
Entry
C8233_00775       CDS       T05423                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
haf  Halomonas sp. SF2003
Pathway
haf00061  Fatty acid biosynthesis
haf00780  Biotin metabolism
haf01100  Metabolic pathways
haf01130  Biosynthesis of antibiotics
haf01212  Fatty acid metabolism
Module
haf_M00083  Fatty acid biosynthesis, elongation
haf_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:haf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C8233_00775
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C8233_00775
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    C8233_00775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:haf01004]
    C8233_00775
Enzymes [BR:haf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     C8233_00775
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     C8233_00775
Lipid biosynthesis proteins [BR:haf01004]
 Fatty acid synthase
  Component type
   C8233_00775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AVV32408
LinkDB All DBs
Position
complement(204381..205205)
Genome map
AA seq 274 aa AA seqDB search
MSLQSPDSSETPGTADSPAPLKPLEGKVVLVVGVANAHSIATGCVKAFRAAGAHIVMTYL
NAKARAYVEPVAKEVGAALLLPLDVEAAGEMETVFSQIETRFGRLDVLVHSIAYCPLEDL
HGRVTDCSRQGFSRAMDISVHSLIRMARLAEPLMFEGGSILAMSYYGGEKVVDHYNIMGP
VKAALEGTVRSLAVELGPRHIRVNALSPGPLKTRAGSGIAHFDELIDDARTRAPEGVLVT
IEDVGNLAVIYASPATRRVTGETVHIDGGLHVRA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctccaatcgccagactcatctgagactcccggtacagctgactctcccgcccct
ctcaagccgcttgaaggcaaggtagtgctggtggtgggcgtggcgaatgcgcattccatt
gctaccggctgcgtgaaggcgtttcgtgcggccggagcacacatcgtgatgacctatctg
aatgccaaggccagagcctatgtggagcctgtggcaaaggaggtgggtgcagcgctgctg
ttgccgctggatgtcgaggccgcaggcgagatggaaaccgtgttttctcagatcgaaact
cgcttcgggcgcctcgatgttctggtgcactccatcgcctattgtccgctggaagacctg
catggccgggtaacggactgttcacgccaaggcttctcacgcgcgatggatatctcggtg
cactcattgatccgcatggcacgattggccgaaccattgatgttcgaaggtggcagcatc
ctggccatgagttattacggcggcgagaaggtagtcgatcactacaacatcatggggccg
gtcaaggcggcactggagggaacggtacgctcgttggccgtggagctggggccacgtcat
atccgtgtcaatgccctgtcaccgggcccactcaagacacgcgccgggtccggcatcgca
catttcgatgagctgatcgacgatgctcgtactcgcgcccctgaaggtgttctggtgacg
atcgaggatgtcggcaacttggcggtgatttacgcaagccccgcgacccgtcgcgtcaca
ggggaaacggtccatatcgatggaggtctgcatgtccgagcatga

DBGET integrated database retrieval system