KEGG   Halomonas sp. SF2003: C8233_08535Help
Entry
C8233_08535       CDS       T05423                                 

Gene name
lpdA
Definition
(GenBank) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
haf  Halomonas sp. SF2003
Pathway
haf00010  Glycolysis / Gluconeogenesis
haf00020  Citrate cycle (TCA cycle)
haf00260  Glycine, serine and threonine metabolism
haf00280  Valine, leucine and isoleucine degradation
haf00310  Lysine degradation
haf00380  Tryptophan metabolism
haf00620  Pyruvate metabolism
haf00630  Glyoxylate and dicarboxylate metabolism
haf00640  Propanoate metabolism
haf01100  Metabolic pathways
haf01110  Biosynthesis of secondary metabolites
haf01120  Microbial metabolism in diverse environments
haf01130  Biosynthesis of antibiotics
haf01200  Carbon metabolism
Module
haf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
haf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
haf_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
haf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:haf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C8233_08535 (lpdA)
   00020 Citrate cycle (TCA cycle)
    C8233_08535 (lpdA)
   00620 Pyruvate metabolism
    C8233_08535 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    C8233_08535 (lpdA)
   00640 Propanoate metabolism
    C8233_08535 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C8233_08535 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    C8233_08535 (lpdA)
   00310 Lysine degradation
    C8233_08535 (lpdA)
   00380 Tryptophan metabolism
    C8233_08535 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:haf04147]
    C8233_08535 (lpdA)
Enzymes [BR:haf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     C8233_08535 (lpdA)
Exosome [BR:haf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   C8233_08535 (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_binding_2 FAD_binding_3 HI0933_like FAD_oxidored Thi4 NAD_binding_8 DAO AlaDh_PNT_C 3HCDH_N K_oxygenase Amino_oxidase 2-Hacid_dh_C Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AVV33714
LinkDB All DBs
Position
complement(2083431..2084870)
Genome map
AA seq 479 aa AA seqDB search
MADKFDVIVIGAGPGGYVAAIRAAQLGLKTACVEKWVNKEGKVVHGGTCLNVGCIPSKAL
LETSHKYVEARDEFAELGIKADGVEIDVAKMIERKAQIVKNLTGGISGLFKANGVTALEG
TGKVLPNKQVEVTDHDGGKATYEAENIVIASGSVPVEIPPTPLTEGLIVDSTGALEFDEA
PKRLGVIGAGVIGLELGSVWSRCGSEVTVLEAVDSFLPMVDAAVAKEAQKLLKKQGLDIK
LGARVTGSDIKDSEVVVKYTDANGEQEQTFDKIIVAVGRRPYTQSLLDSDVGINLDERGF
IHVDDQCATSVPGVYAIGDVVRGPMLAHKASEEGVMVADIIAGHKAEMNYDAIPSIIYTF
PEVAWVGKTEQQAKSEGIEVKTGSFPFAASGRAMANNATEGLAKIIADAETDRVLGVHII
GQHAGELIAQGVTALEFGASAEDLALICTAHPTLSEAVHEAALAVDGHAIHIANRKKRK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggccgataaatttgatgtgatcgtcattggcgctggccctggtggctatgttgccgct
atccgcgctgctcagctgggtctgaagaccgcctgcgtcgagaagtgggtcaacaaggaa
ggcaaggtcgttcacggcggtacctgcctgaacgtcggctgtattccgtccaaggcattg
ctggaaacctcgcacaagtacgtcgaagcgcgtgatgaattcgccgaactgggcatcaag
gccgacggcgtcgagatcgacgtggccaagatgatcgagcgcaaggcgcagatcgtgaag
aacctgaccggcggtatctccggtctgttcaaggccaacggtgtcaccgcgctggaaggt
accggcaaggtgctgccgaacaagcaggtcgaagtgaccgatcacgacggtggcaaggcg
acctatgaagccgagaacatcgtcatcgcgtcgggctccgtgccggtcgagattccgccg
acgccgctgaccgaaggtctgatcgtcgattccaccggcgcgctcgagttcgacgaagcg
ccgaagcgtctgggtgtcatcggtgccggtgtcatcggtctcgagctcggtagcgtgtgg
agccgttgcggttctgaagtcaccgtgctggaagcggtcgacagcttcctgccgatggtc
gatgcggccgtcgccaaggaagcccagaagctgctcaagaagcagggtctggacatcaag
ctcggcgcccgtgtgaccggttccgacatcaaggacagcgaagtcgtcgtcaagtacacc
gacgccaacggcgaacaggaacagaccttcgacaagatcatcgtcgcggtcggccgtcgt
ccgtacacccagagcctgctcgacagcgatgtcggcatcaatctggacgagcgtggcttc
atccacgtcgacgaccagtgcgcgaccagcgtgccgggcgtctacgccatcggcgacgtg
gtgcgtggcccgatgctggcgcacaaggcctctgaagagggcgtgatggttgccgacatc
atcgccggccacaaggccgagatgaactacgacgccatcccgagcatcatctacaccttc
ccggaagtggcgtgggtcggcaagaccgaacagcaagccaagtccgaaggcatcgaagtc
aagaccggcagcttcccgttcgcggcaagcggtcgtgccatggccaacaatgccactgaa
ggtctggccaagatcattgccgacgctgagactgatcgcgtcctgggcgttcacatcatc
ggccagcatgccggtgagctgatcgcacagggtgtgactgccctcgagttcggcgcaagc
gccgaagacctcgcactgatctgcacggctcacccgacactgtcggaagccgtgcacgaa
gccgcgctggccgttgacgggcatgcgattcacatcgcaaaccgcaagaagcgcaagtaa

DBGET integrated database retrieval system