KEGG   Halomonas sp. SF2003: C8233_11420Help
Entry
C8233_11420       CDS       T05423                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
haf  Halomonas sp. SF2003
Pathway
haf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:haf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C8233_11420 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:haf02000]
    C8233_11420 (pstB)
Enzymes [BR:haf01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     C8233_11420 (pstB)
Transporters [BR:haf02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    C8233_11420 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_15 RsgA_GTPase AAA_16 TniB AAA_29 Rad17 AAA_23 IstB_IS21 AAA_5 AAA_7
Motif
Other DBs
NCBI-ProteinID: AVV34178
LinkDB All DBs
Position
2756132..2756977
Genome map
AA seq 281 aa AA seqDB search
MRRDSEQPKPQLFLQETPARPAEDICLETRHLSLDYQARVGKENQTRRALEDVSLQIARK
RVTAFIGPSGCGKSSLLRTFNRMTDLDEQSRLSGKVLLEGEDIHARGVDVPMLRRRIGMV
FQTPNPFPMSVYENVAFGLRLVGENDKRHLDDKVESCLRSAALWEEVKDRLHDSALGLSG
GQQQRLVIARTLAVEPEVLLLDEPASALDPISTLKIEELIRSLRSRLTLIIVTHNMQQAA
RVSDDTAFLHEGRLVEFAPTDQLFTNPRRRQTEDYITGRFG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtgactctgaacagcccaagccccagttgtttcttcaggagacgcctgcgcgg
ccggctgaggacatctgtctggaaacccgccacctgagcctcgattatcaggcacgtgtc
ggcaaggagaaccagacgcgacgcgcactggaggacgtcagcctgcagatcgcgcgcaag
cgcgtgacggccttcatcgggccttccggctgcggcaagtcgagtctgttgcgtaccttc
aatcgcatgaccgatctcgacgaacagtcacgtctttccggcaaggtactgctcgagggc
gaggacattcatgcgcgcggcgtggacgtgccgatgctgcgccgccggatcggcatggtc
ttccagacgcccaatccctttccgatgtcggtctacgagaacgtggccttcgggctgcgg
ctggtcggcgagaatgacaagcgccacctcgatgacaaggtcgaatcctgtctgcgctcc
gcggcgctgtgggaagaagtgaaggatcgcctgcacgacagcgcgctggggctctcgggt
ggccagcaacagcggctggtgatcgcgcggacgctggcggtcgagccggaggtgctgctg
ctggatgaaccggcctcggcgctggaccccatctcgacgctcaagatcgaggagctgatc
cgttcgctgcgctcgcgcctgacgctgatcatcgtcacgcacaacatgcagcaggccgcg
cgggtgtcagacgataccgccttcctgcatgagggccgcctggtggaattcgccccgacc
gatcagctgttcaccaacccgcggcgccgccagacggaagactacatcacggggcgtttc
ggttag

DBGET integrated database retrieval system