KEGG   Halomonas sp. SF2003: C8233_12980Help
Entry
C8233_12980       CDS       T05423                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
haf  Halomonas sp. SF2003
Pathway
haf00061  Fatty acid biosynthesis
haf00780  Biotin metabolism
haf01100  Metabolic pathways
haf01212  Fatty acid metabolism
Module
haf_M00083  Fatty acid biosynthesis, elongation
haf_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:haf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C8233_12980 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C8233_12980 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:haf01004]
    C8233_12980 (fabZ)
Enzymes [BR:haf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     C8233_12980 (fabZ)
Lipid biosynthesis proteins [BR:haf01004]
 Fatty acid synthase
  Component type
   C8233_12980 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_2 PS-DH TctC DUF2808
Motif
Other DBs
NCBI-ProteinID: AVV34442
LinkDB All DBs
Position
3105536..3105973
Genome map
AA seq 145 aa AA seqDB search
MDVNEIREYLPHRYPFLLIDRVMDLTLGEFIVARKNVSINEPFFNGHFPEHPIMPGVLIV
EAMAQAAGILGFKTVDKRPADGYIYYLVGSDNVRFKRPVMPGDQLEISARVLREKRGIWK
FACQAKVDGDLVCEAEIICAERKVA
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaacgagatccgtgagtatctcccgcaccgctatcctttcctgctgatcgat
cgtgtcatggacctgacccttggcgagttcatcgtcgcgcgcaagaacgtcagcatcaat
gagccgttcttcaatggtcacttcccggagcacccgatcatgccgggcgttctgatcgtg
gaagccatggctcaggcggcgggtatactcggcttcaagaccgtcgacaaacgtcccgcc
gatggctacatctattatctcgtcggaagcgacaatgtgcgcttcaagcgcccggtgatg
ccgggtgaccagctcgagatcagcgcccgcgtgctgcgcgagaagcgtggcatctggaaa
ttcgcctgtcaggccaaggtcgacggcgatctggtctgcgaggccgaaatcatctgtgcc
gagaggaaggtcgcttga

DBGET integrated database retrieval system