KEGG   Halomonas sp. GFAJ-1: BB497_03840Help
Entry
BB497_03840       CDS       T05375                                 

Definition
(GenBank) DNA gyrase subunit B
  KO
K02470  DNA gyrase subunit B [EC:5.6.2.2]
Organism
hag  Halomonas sp. GFAJ-1
Brite
KEGG Orthology (KO) [BR:hag00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hag03032]
    BB497_03840
   03400 DNA repair and recombination proteins [BR:hag03400]
    BB497_03840
Enzymes [BR:hag01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     BB497_03840
DNA replication proteins [BR:hag03032]
 Prokaryotic type
  DNA Topoisomerases
   BB497_03840
DNA repair and recombination proteins [BR:hag03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      BB497_03840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB GyrB_insert DNA_gyraseB_C HATPase_c Toprim HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AVI61891
UniProt: H0J2I1
LinkDB All DBs
Position
complement(845615..848035)
Genome map
AA seq 806 aa AA seqDB search
MSEQAYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFELVDNSIDEALAGHCSEV
RVVIHPDESVTVSDNGRGVPTELHEGEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVG
VSVVNALSEELRLTIWRQNEVFEQIYRHGVPQAPLGVVGKTEKTGTSIHFRPSPDTFANI
EFHYDILAKRLRELSFLNSGVAIRLVDERSGKEELFHYEGGLKAFVDHLNKNKTVLNPVF
HFNAVREDGVEVEVAMQWSEAFTENIFCYTNNIPQRDGGAHLAGFRAGLTRTLNNYIEAE
GLLKKSKVNTSGDDAREGLTAVISVKVPDPKFSSQTKEKLVSSEVKTAVEQEMGRLFSEY
LIEKPSEAKSIVNKMLDAARAREAARKARDMTRRKGALDIAGLPGKLADCQEKDPSQSEL
YLVEGDSAGGSAKQGRDRRTQAILPLKGKILNVEKARFDKMLSSAEVGTLITALGCGIGR
EEFNPDKLRYHSVIIMTDADVDGSHIRTLLLTFFFRQMPELIERGHIFIAQPPLYKIKRG
KQELYLKDEQAMVDYLTTTALDGAGLHVNADAPGITGSQLEALVNQYRNVMKRIDRLARV
YPIEVLKQTVHTAALLGETSLKDRVTMENWIAELQKAMDDKVAYEGGPRYQFYIHEDTER
GLHLPAVSLIAHGVTTEYVWGLDFFESADYRAITGLGDTLNGLLEEGAYIARGERQKPVS
HFSEVLAWLMQEGQRGLSFQRYKGLGEMNPDQLWETTMDPDSRRMLRVTIEDAVAADMMF
NTLMGDEVEPRREFIETNALVANLDV
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaggcttacgattcatcaagcatcaaggtgctcaaagggctagatgcagta
cgcaagcgcccaggtatgtatatcggtgacaccgacgacggtaccggtctgcaccacatg
gttttcgagttggtggataactccatcgatgaggctttggcaggccactgcagtgaagtt
cgagtggttattcaccccgatgaatcagtaactgtcagtgataacggccgtggtgttcct
accgagcttcatgaaggggaaggggtgtcagcagcagaagttattatgacggtgctgcat
gctggcggtaagtttgatgacaactcttataaagtctcaggtggacttcacggtgtaggg
gtttcggttgtcaacgcgctgtcggaagagctgcgtttgaccatatggcgccaaaatgaa
gtgtttgagcagatttatcgccacggcgtaccacaagcaccgctaggtgtggtgggtaaa
actgaaaagactggcactagcatccatttccgtccatcaccggatacattcgcaaatatc
gaatttcattacgatattttagcaaaacgcctgcgtgagctctctttcttaaattcaggt
gttgccattcgtctagtggatgagcgcagcgggaaagaagagctgtttcattatgaaggt
ggtctaaaagcatttgttgaccacctgaataagaataaaactgtcttgaatccggttttt
cattttaatgcagtgcgtgaagatggcgttgaagtagaagtcgccatgcagtggagcgaa
gccttcacagaaaatattttctgttataccaacaatattccacagcgagatggcggtgcc
cacttggcgggtttccgtgcggggctgacccgtacgctcaataactacattgaagcggaa
gggttgctgaaaaaatccaaagtaaatacctcgggcgacgatgcgcgcgagggtttaacc
gcggttatatctgttaaggttccagaccctaagttctcgtctcaaactaaggaaaagctg
gtttccagtgaagtaaaaacagctgttgagcaggagatgggcaggctgttttcagagtac
ttaattgaaaagcctagtgaagcaaaatccatcgtcaacaaaatgctggatgccgcccgc
gcccgtgaagctgcccgtaaagcgcgggatatgacacgacgcaaaggcgcgctggacatt
gccggtttgccgggcaagctggcggactgccaagaaaaagatcctagccagtcagaactc
tatttggtggagggtgattcggcaggtggcagcgcgaaacaggggcgagaccgccgcacc
caagcgattttaccgctgaaaggtaagatcctaaacgttgagaaagcacgcttcgacaaa
atgctttcgtcagcggaagtgggcacgttaattactgcgcttggctgtggcattgggcgg
gaagagtttaaccctgacaagctgcgctaccattcggtcattattatgaccgacgcggat
gtagacggctctcacattcgcacactgcttctgacgttctttttccgacaaatgccggag
ctgattgaacgtggccacatctttattgcccagccgccgctatataaaatcaagcgaggc
aagcaagagctttaccttaaagatgagcaggcaatggtcgactacctgacgaccaccgcg
ctggatggagcggggcttcacgtgaatgccgatgcgccaggcatcacgggctcacagctg
gaagcgctggttaatcagtatcgcaacgtgatgaaacgaatcgatcgcctagcccgtgtc
tatccgattgaagtgctcaagcagacggtgcacacagcggcgctgctaggcgaaacgagc
ctgaaagatcgggtgacaatggaaaactggatcgctgagcttcaaaaagcgatggacgat
aaggtggcctatgaaggtggccctcgttaccagttctatattcacgaagatactgaacgt
ggtctgcatttgcccgcggtgtcgctcattgcccatggggtaaccacagagtacgtttgg
ggcttggatttctttgaaagcgccgactaccgcgccattaccgggttaggcgatacgctc
aatgggctgttggaggagggggcttatattgcccgtggtgagcggcagaaaccggtttcc
cacttctccgaggtgctggcttggttaatgcaagaaggtcagcgtgggctctctttccag
cgctataaagggttgggtgagatgaatcctgaccagctttgggagaccaccatggatcct
gacagccgccgcatgctgcgcgttactatcgaagatgcggttgccgccgacatgatgttc
aatacgctcatgggagatgaagttgaacctcgtcgcgagtttattgagacaaatgcgcta
gtggctaatcttgatgtctag

DBGET integrated database retrieval system