KEGG   Halomonas sp. GFAJ-1: BB497_09170Help
Entry
BB497_09170       CDS       T05375                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hag  Halomonas sp. GFAJ-1
Brite
KEGG Orthology (KO) [BR:hag00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BB497_09170
Enzymes [BR:hag01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BB497_09170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO Glutaredoxin Thi4 FAD_oxidored K_oxygenase FAD_binding_3 FMO-like Methyltrn_RNA_4 DUF3467
Motif
Other DBs
NCBI-ProteinID: AVI62851
UniProt: H0J4Y1
LinkDB All DBs
Position
complement(1990546..1992102)
Genome map
AA seq 518 aa AA seqDB search
MLDANLKNQLKAYLEKVTQPFEIVASLDDGAKSQELLGLLEDISSLTDKITLHSDGQDSR
KPSFAINRPGEETGVVFAGIPMGHEFTSLVLALLQVGGHPPKTSQELLDQIKNLDGDMLF
ETYYSLSCQNCPDVVQALNLMAIFNPNVRHVAIDGALFQDEVEAREIMSVPSIYLNGKPF
DQGRMTLEQILAKVDTGAAEREAKKLSEKAAFDTLVIGGGPAGASAAIYSARKGINTGVA
AERFGGQVADTMGIENFISVSHTEGPKLVSALEEHVKEYEVDVMNLQRATSFKAAEAEGG
LHEVTLESGAKLKSKTLVLATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLVEFMGEMRADAVLQRKLKSLPNVDIILNAQTTEVTGDG
SRVNGLTYKDRTTDDIKTIALEGIFVQIGLVPNTEWLKGSPIEMTPRGEIIVDAHGMTSV
PGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDYLIRN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgctaatttaaaaaaccagttgaaagcttatctggaaaaagtgactcaaccg
ttcgagatcgttgcgtccctcgatgacggtgccaagtcacaagaactgctgggcctgctg
gaagatatcagcagcctcaccgataaaattactctgcacagcgatggccaagatagccgc
aagccatcctttgctattaatcgccccggtgaagagaccggcgtggtatttgcaggtatc
cccatgggccacgagttcacctcgctggtactggcgctgctgcaagtcggtggccaccca
ccgaaaacctctcaagaactgctggatcaaatcaagaacctcgacggcgacatgctgttc
gagacttactactcgctttcgtgccagaactgccctgatgtcgttcaagcgctcaactta
atggcgatctttaacccgaacgtgcgtcacgtcgccattgatggcgcgctgttccaggat
gaagtagaagcgcgggaaattatgtcggtgcccagcatctacttaaacggcaagcctttt
gaccagggtcgcatgacacttgagcaaatcttagccaaagtagacactggcgctgccgag
cgtgaagcgaaaaagcttagcgaaaaagccgcctttgatacgctagtgattggtggtggc
cccgccggtgcatcagcagccatttactctgcccgcaaaggcattaacaccggtgttgct
gcagagcgctttggtggccaagtggccgacactatgggcattgagaactttatttcagtt
tcccataccgaaggcccaaagctagttagcgcattggaagagcacgtcaaagagtacgag
gttgacgtaatgaaccttcagcgcgctacgtcattcaaggctgctgaagcggaaggcggt
ttgcatgaagtcaccctggagtccggcgcgaagctaaagagcaaaacactcgtgctagcc
actggcgcacgctggcgtgaaatgaatgttcccggtgagcagcagtaccgtaacaaaggc
gtggcttattgcccccattgcgatggcccactgttcaaaggcaagcgcgttgccgttatt
ggtggcggcaactctggtgtagaagcggccattgaccttgcgggcatcgtgggtcacgta
acgctggtagagttcatgggtgaaatgcgcgcagatgccgtgctgcagagaaaactcaag
agcctgcccaacgtcgatattattttgaacgcgcaaaccaccgaagtaaccggcgatggc
agccgcgttaacggcctaacctataaagaccgtactaccgatgacatcaaaaccatcgcg
ttagagggtatttttgttcagattggcttggtacctaataccgagtggctgaaaggctca
ccgattgagatgacgccccgcggagagattattgtcgatgcccatggcatgacctcggta
cccggtgtgtttgctgcaggggatgtcaccaccgtgccctataaacagatcattattgcc
atgggcgaaggcgcaaaagcctcgctaggcgcctttgattatctgattcgcaattaa

DBGET integrated database retrieval system