KEGG   Halomonas sp. GFAJ-1: BB497_10695Help
Entry
BB497_10695       CDS       T05375                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hag  Halomonas sp. GFAJ-1
Pathway
hag00473  D-Alanine metabolism
hag00550  Peptidoglycan biosynthesis
hag01100  Metabolic pathways
hag01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BB497_10695
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BB497_10695
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BB497_10695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hag01011]
    BB497_10695
Enzymes [BR:hag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BB497_10695
Peptidoglycan biosynthesis and degradation proteins [BR:hag01011]
 Precursor biosynthesis
  Amino acid ligase
   BB497_10695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3 GARS_A RimK ATPgrasp_YheCD TTL ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AVI63125
UniProt: H0J463
LinkDB All DBs
Position
2379463..2380404
Genome map
AA seq 313 aa AA seqDB search
MSAQVSQADRLARVVVVYGGRSAEREVSLKSGAAILDALKRQGIQAIGYDLRENGLVGLE
QLAPTAVFVALHGRGGEDGTFQGALELLNIPYTGSGVLASALGMDKQRTKQVWQAVGLPT
PESITLNAESNWASVVTQLGLPMMVKPVHEGSTLGISIVKSQEELVSAYHAATKYDARVM
AERFIVGEEYTVALLGDEVLPAIRVEVPGGFYDYEAKYIANTTQYHLPCGLEAQDEQALA
SLCQQAFAAIGGEGWGRVDVMRDADGKFWLIEVNTVPGMTDHSLVPQAAAHAGIGFDQLV
VQILQTAGKQSSS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcccaagtatcccaggcagatcgcttagcgcgggtggttgtggtctacggtgga
cgatccgccgagcgtgaagtatcgcttaaaagcggtgccgctattttggatgccttgaag
cggcaagggattcaggcaatcggctacgacctgcgagaaaatggcttagttggccttgaa
caattggctcccacggctgtatttgttgctctgcacggtcgtggtggtgaggatggtact
ttccagggagcgctggagcttttaaatattccctacactggcagcggtgttttagcctcc
gctctaggtatggataaacagcgcacaaagcaggtttggcaagcggtgggcttgccaaca
ccagaaagcattacgttgaatgctgagtcaaattgggcgtcggtggtcacccagttaggg
ctgccgatgatggtaaagcccgtccacgaaggctccacgctgggtattagtatcgttaaa
agccaagaagagttggtgtcagcctaccatgctgcaaccaagtacgatgcccgtgtcatg
gcggagcggtttattgtcggtgaagagtacaccgttgcactgctgggtgatgaagtactc
cctgcgatacgcgtcgaggtgccgggaggtttttatgattacgaggctaaatacattgcc
aataccacccagtatcatcttccttgtggtttagaagcccaggatgaacaagcgctagca
tcgctttgccaacaagcatttgcagccattggtggtgagggctgggggcgtgtcgatgtt
atgagggatgctgatggcaaattctggctaatcgaggtcaataccgtgccaggaatgacc
gaccatagtttggtacctcaggcggctgcgcatgctgggattggttttgatcagctggta
gtgcagatactgcagactgctggcaaacagagctcatcatga

DBGET integrated database retrieval system