KEGG   Halomonas sp. GFAJ-1: BB497_13880Help
Entry
BB497_13880       CDS       T05375                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
hag  Halomonas sp. GFAJ-1
Pathway
hag00550  Peptidoglycan biosynthesis
hag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hag00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BB497_13880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hag01002]
    BB497_13880
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hag01011]
    BB497_13880
Enzymes [BR:hag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BB497_13880
Peptidases and inhibitors [BR:hag01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BB497_13880
Peptidoglycan biosynthesis and degradation proteins [BR:hag01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BB497_13880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AVI63720
LinkDB All DBs
Position
complement(3080527..3081726)
Genome map
AA seq 399 aa AA seqDB search
MNIVMSFRRSAQLCLFAAMTVVALPASAQPVPQPQTIIPAAPQLAASSWILMDAHSGRVL
AEHNSDERLPPASLTKLMTAYLVERELDRGTISLTDMVNISERAWRTGGSKMFIEVGDRV
SVDDLLHGIVIVSGNDASVAIAEHLAGGEAPFADLMNQHATRLGMNNTNFQNATGLPGDN
HYSTARDMALLSQYIINDYPEHYAIYSQRTFSFSGIDQPNRNRLLWRDPTVDGLKTGWTT
EAGYGLVASAKRDDMRLISVVMGTSSEEARAQETQKLLSYGFRFYETMKLYERGAVLATP
RVWGGEMNELRVGVNEEVFMTLPRNRNEELRARLNLKQDLQAPVAVGDEVGTLEVYLGED
MVGERQLVALENVEEGGLFKRLFDQVRRFFSGLVSNFTG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagtaatgtcgtttcgtcgttcagcccagctctgcttgtttgcagcaatgacg
gtggtagcgttacctgcctcggcccagcccgttcctcagccgcagacaattattccagct
gcgccacagcttgcggcaagctcgtggatactgatggatgctcatagcgggcgtgtgctt
gctgagcataactctgatgagcgtttgcccccggcgagtctcactaagctgatgacggct
tacctagtcgagcgtgagttggatcgcggcaccattagcctcaccgatatggttaacatc
agcgaaagggcatggcgcaccggcggctccaaaatgtttattgaagtgggcgatcgtgtc
tcagtcgatgatctgttgcatggcatagttattgtttcaggcaacgatgccagtgtcgct
attgccgagcacttggctgggggggaagcaccctttgcggatttaatgaaccagcatgcc
acgcgtttaggcatgaataatacaaactttcaaaatgccaccgggctgccgggtgacaat
cactactcaaccgctcgtgatatggcgctgctttctcaatacatcatcaatgattaccct
gagcactatgcgatttactcccagcgcactttctcctttagcggcatcgaccaacctaat
cgcaaccggctgctttggcgcgaccccacggttgatggcttgaaaaccggctggacaact
gaggctggttacggcttggtagcctcagccaagcgtgatgatatgcgtctaatatctgtt
gtgatgggtacaagttctgaggaggcgcgcgctcaagagacgcagaaactgctcagctac
ggctttcgcttctatgaaaccatgaagctctatgaacgaggcgctgttcttgcgacgccg
cgggtgtggggtggcgaaatgaacgaactacgggttggagttaacgaagaagtattcatg
acgctaccgcgcaatcgcaatgaagagcttcgcgcgcgccttaatcttaagcaagacctg
caagcgcccgttgctgtaggcgatgaagtaggtaccttagaagtgtatcttggcgaggat
atggttggtgagcgtcaactggttgcccttgaaaatgttgaagagggtgggttgtttaag
cgattgtttgatcaggtaaggcgctttttcagcggcttggtcagcaacttcaccggctaa

DBGET integrated database retrieval system