KEGG   Halophilic archaeon DL31: Halar_1450Help
Entry
Halar_1450        CDS       T01603                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hah  Halophilic archaeon DL31
Pathway
hah00564  Glycerophospholipid metabolism
hah01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Halar_1450
Enzymes [BR:hah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Halar_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Pyr_redox HI0933_like NAD_binding_8 FAD_binding_3 Pyr_redox_3 3HCDH_N Amino_oxidase Thi4 Lycopene_cycl ApbA
Motif
Other DBs
NCBI-ProteinID: AEN05186
UniProt: G2MKT5
LinkDB All DBs
Position
complement(721812..723020)
Genome map
AA seq 402 aa AA seqDB search
MSEETAVAVIGGGATGVGVARDLAMRGVEVTLLERGEGLNAGTSGRSHGVLHSGARYADS
DPEGAAECIRENRVLREIAPGCVADTGGLFLHLDGDDPDYFERKVAACREVGISADSLDA
AEIRERVPGRSENVVRGFAVPDGVVYPSRLVAATAASARDHGAEIATGSPVEEIDATGNS
VTLSIGDDDPRTLEATTVVNAAGPWAGKVAALAGADLRMRPTRGVMVAVDYPGVEPVLNR
CRAPADGDIVVPHGKQVVLGTTSVAVDDPDDFEQADWEVERTVSECSAMVPQLADAAVER
TYWGLRPLYEPEEAAERRGISRGFTVLDHDEAPGLVSVVGGKLTTYRLMAEAVADHLCDD
LGVESPCKTADEVLPGADDAERLDELVAAFGAAGPADSNIVH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggagacggcggtcgcggtcatcggcgggggcgcaaccggtgtcggcgttgct
cgtgacctagcgatgcggggcgtcgaggtgacgctgctggaacgtggtgaggggctaaac
gccggcacctccgggcgctcacacggcgtcctccacagcggtgcgcgctacgccgatagc
gacccagagggcgcggctgaatgcattcgagagaaccgcgtactcagggaaatcgcacct
ggctgtgtggccgacactggcggtctgtttctccacctcgacggtgacgaccccgactac
ttcgagcggaaggtcgcagcgtgccgcgaagtggggatctccgccgactcgctggacgcg
gcggagattcgggaacgagtgccggggcgtagcgagaatgtcgttcgcgggttcgctgtc
ccggatggcgtcgtgtacccctctcgactggtcgccgcaacagcagcaagcgccagagat
cacggtgcagaaatcgccactggaagccccgtcgaggaaattgacgcgaccgggaattct
gttaccctctctattggggacgatgacccgcgcacgctcgaggccaccacggtcgtcaac
gctgccgggccgtgggcagggaaggttgcagctttggctggcgcagacctacggatgcgc
ccgacgcgtggtgtcatggtcgccgtcgactacccgggcgtagagccagttctgaaccgc
tgtcgagcaccagctgacggagacatcgttgtcccgcacggcaagcaggtcgtgctcggc
acgaccagcgtcgcggtcgacgacccagacgacttcgagcaggccgactgggaggtcgag
cggaccgtctccgagtgttcggcgatggtgccacagcttgccgacgcggcggtggaacgg
acctactgggggcttcggccgctctacgaacccgaggaggcggccgagcgccggggcatt
tcgcggggcttcacggtcctcgaccacgacgaggcgcccgggttggtgagcgtcgtcggc
ggaaaactcacgacctatcgcctgatggccgaagctgtcgctgaccacctctgtgacgac
cttggcgtcgagtcgccctgtaagacggccgatgaggtgctcccgggcgctgatgacgca
gagcggctggacgaactggtcgcagcgttcggtgcagccgggccggcggacagcaatatc
gtccactaa

DBGET integrated database retrieval system