KEGG   Halophilic archaeon DL31: Halar_1545Help
Entry
Halar_1545        CDS       T01603                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hah  Halophilic archaeon DL31
Pathway
hah00240  Pyrimidine metabolism
hah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Halar_1545
Enzymes [BR:hah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Halar_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 zf-C4_ClpX
Motif
Other DBs
NCBI-ProteinID: AEN05277
UniProt: G2MJ45
LinkDB All DBs
Position
complement(812536..813123)
Genome map
AA seq 195 aa AA seqDB search
MHKITGSGWVEVVTGSMFSGKTEELLRRLRRAEIAGQDVIAFTPAIDDRYGDTTIGSHEG
RQWDAQVVDNEGAGVWDIEDHLNGQEVVAIDEANFFDNDLVDVCEKLAADGRRVVVSGTD
ITFRGEPFTPLPAVMATAEYVDKLRAICSVCGEPATRNQRLVDGEPAHIDDPTIVVGAEE
SYEARCRNCHTLRSD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagatcaccgggagcggctgggtcgaggtggtcaccggctcgatgttctctggg
aagaccgaggaactcctgcgtcggctgcgccgtgccgagatcgcgggccaggacgtcatc
gccttcacgcccgctatcgacgaccgctacggcgacacaaccatcggctcccacgagggc
cgtcagtgggacgcacaggttgtcgacaacgagggggccggcgtttgggatatcgaggac
cacctcaacgggcaggaggtagtcgccatcgacgaggcgaacttcttcgacaacgacctc
gtggacgtctgtgagaagttggccgccgacgggcggcgcgtcgtcgtctcggggaccgat
atcaccttccgcggcgagccgttcacacccctgccagcggtgatggcgacggctgagtac
gtcgacaaactgcgagccatctgttcggtctgtggcgaacccgcgacccggaaccagcgg
ttggtggacggggaacccgcccacattgacgacccgactatcgtcgtcggagccgaggag
tcctacgaggcacgatgccggaactgccacacgctgcgtagtgactga

DBGET integrated database retrieval system