KEGG   Hahella sp. KA22: ENC22_09440Help
Entry
ENC22_09440       CDS       T05793                                 

Definition
(GenBank) hypothetical protein
Organism
hahe  Hahella sp. KA22
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGE-sulfatase Pkinase Pkinase_Tyr PEGA CarboxypepD_reg APH Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AZZ91417
UniProt: A0A3T0VJP9
LinkDB All DBs
Position
2107998..2110202
Genome map
AA seq 734 aa AA seqDB search
MDWSCSVITVSPQIPNYEMLDEVAEGGMAKVFKARQLLADRIVAIKIISPAICLNKEFRQ
RFIQEAQITAKLNHPNIIQIYDIAPFEDTFFISMEFMEGGSLTERIRSGRLTRDESTRII
LQLAEAMNYAHKLGYIHRDIKPGNILFRADDTPVLSDYGIAKSLYHRGDLTTTGSILGSP
PYMSPEQAMGRQLDHRADWYSLGIVFYQMLTGAVPFEATDPISLGIKHKQEPPPPLPAHL
RMYQQLMDLLLAKEPERRLSSLDEFRAHLEAIKNVPVDTEATCLFTVESLKTAHGETAAQ
ESPTSTRRTERGGSVSSGVWRALGVALMIAAVVGYGAYKNMTRPAPTFPFVVVTEPVGAT
VTFAGEESAYTPGAPLPEGDYEVEVTAKGFWPKTFTLNHSADHRSHYVSLKPAKTAFTVD
VTPVDAKIRILNIQPKYEEGIPLDPGRYLLEVSAPGYEKLTRWTEISGEQFTEQVFLVEK
DALESLNIAFVDIPGGKYRMGFDDGGVLWGGDQGQEVTLTPFKIMAYEVTFEQWDACVAD
GGCTNKADDRGWGRGRNPVISVSWNDAEEFAAWLSAKTGRSFQLPTEAQWEYAARAGSRK
RFSWGDQVGHKFANYGKDDCCGGLVSGADKWQFTSPVGSFPANQWGVYDMHGNVWEWVQD
CWSESMKGVPADGSARTAGDCRRRVLRGGSWYSPPKSMQLVSRDANGVDVRYQVNGFRLV
ETPTQAPAAGPATQ
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggactggagctgcagcgtgatcaccgtatctcctcaaattcccaattatgaaatgctt
gatgaagttgctgaaggtggaatggccaaagtgtttaaggccaggcagcttctcgcggac
cgcatcgtcgccatcaagattatttctccggctatctgtctcaacaaagagtttcgtcaa
cggtttattcaggaagcgcaaatcaccgccaagctgaatcacccgaatatcattcagata
tacgacatcgcgccttttgaggacaccttctttatttccatggagttcatggaaggcggt
tcactgacggagcgcatccgttccggccgcctgaccagagacgagtcgacgcgcattatt
ctgcagttggcggaggccatgaattacgcccacaagctgggctatatccatcgcgacatc
aagccgggcaatattctgtttcgcgcggatgataccccagtgctgtcggactacggcatc
gccaagtccctgtatcatcgtggcgacctcaccacgaccggatcgatattgggctcgcct
ccttatatgagccctgagcaggccatgggacgacagcttgatcatcgcgccgattggtac
agtctgggcatcgtgttctatcagatgctgacgggggccgtgccgttcgaggccaccgac
ccgatcagtctgggcatcaagcataaacaggaaccgcctccgcccttgccggcgcacctg
cggatgtatcagcagttgatggacttgttgctggcgaaggagccggagcgtcgattgtcg
tcgttggacgagtttcgcgcgcacctggaagcgattaagaatgtcccggtggatacggaa
gcaacctgtctgtttaccgtcgagtcgttaaaaacggctcatggtgaaacggcggcgcag
gagagtcctacctccactcgcagaacggaacggggcggctctgtgtcttccggcgtctgg
cgcgcgttaggcgtcgccttgatgattgctgcggtagtgggatatggggcctataaaaat
atgacccgacccgcgccgacctttccctttgtcgtggtgacggagccggtaggggcgaca
gtgacattcgccggcgaggagagcgcctatacgccgggcgcgccgctccctgagggtgac
tatgaggttgaagtgaccgccaaagggttctggccgaaaacctttacgttgaatcacagc
gccgaccaccgttcgcattatgtttcgctgaagccggctaaaaccgcctttacggtggat
gtgacgcctgtggatgcgaaaattcgtattctcaatattcagcccaagtacgaagagggt
attccgctggacccaggtcgttatttattggaagtcagcgcgccggggtatgagaagctg
acccggtggacggaaatcagcggagagcagtttaccgaacaggtgtttttggttgaaaag
gatgcgctggaatctctgaatatcgcctttgtcgatattcccggcggcaaatatcgcatg
ggctttgatgacggcggcgtattatggggcggcgatcaggggcaggaagtgacgctgacg
ccgttcaagattatggcctatgaagtgaccttcgagcagtgggacgcctgcgtcgccgat
ggcggttgtacgaacaaagccgatgatcgcggatggggccgggggcgtaatccggtgatc
agcgtgagctggaatgacgcggaagaattcgccgcctggctctccgccaaaaccggcaga
agctttcaattacccacggaagcgcagtgggaatacgccgcgcgggcaggcagccgcaag
cgtttctcctggggagatcaggtcggccacaaattcgccaattacggcaaagacgattgt
tgtggcggattggtgagcggcgccgataaatggcaattcacttcgccagttggctcattc
ccggccaatcaatggggcgtgtacgacatgcacggcaatgtgtgggagtgggtgcaggat
tgctggagtgagtccatgaaaggcgtgccggcggatggctccgcgcgcacggcgggagac
tgtcgacgccgcgtcctgcgtggcggctcctggtatagtccgcccaagtcgatgcagttg
gtcagtcgcgacgccaatggcgttgatgtccgctatcaagtgaacgggttccgactggtg
gagacgccgacccaagctcccgccgcagggcccgccactcagtag

DBGET integrated database retrieval system