KEGG   Hahella sp. KA22: ENC22_22340Help
Entry
ENC22_22340       CDS       T05793                                 

Definition
(GenBank) MarR family transcriptional regulator
Organism
hahe  Hahella sp. KA22
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 Penicillinase_R TrmB PadR Replic_Relax Fe_dep_repress HxlR HTH_IclR HTH_34 Rrf2 HTH_45 HTH_1 HTH_Crp_2 HTH_47
Motif
Other DBs
NCBI-ProteinID: AZZ93779
UniProt: A0A3T0VRA7
LinkDB All DBs
Position
5076631..5077098
Genome map
AA seq 155 aa AA seqDB search
MTRHDEVLVLIRRIIRAADLRSKQLGKETGLTAPQLLILRSIGDSRNTTMSQVAQNISLS
QATVTSIVDRLEKKNLVARIRDSVDKRRIYLVLTDEGKEVLAGAPRPLQELFTSRFDNLP
EWEQYLILASLAKVADMMDATDIDASPLLAVGSVT
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgactcgacacgatgaagtattggtcctgatacgaaggattattcgtgcagcggaccta
cgctccaagcaattgggcaaagaaaccggactcaccgcgccgcagttattaattcttcgt
tccatcggcgactcccgaaacacaacgatgagccaggtcgcgcagaacatcagtctgagc
caggcgacggtcaccagtatcgttgaccgcctggaaaagaaaaatctggtggcgcgtatt
cgcgactcggtagacaaacggcgcatttatctggtgctgacggatgaaggcaaagaagtg
ctggcgggcgccccccggccgctgcaggagctgttcacctcccgcttcgacaacctgccg
gagtgggagcaatatctgatcctggccagcctcgccaaagtcgcggacatgatggacgcc
actgatatcgacgcatcgccgttgctggcggtgggctccgtcacctaa

DBGET integrated database retrieval system