KEGG   Hahella sp. KA22: ENC22_25720Help
Entry
ENC22_25720       CDS       T05793                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
hahe  Hahella sp. KA22
Pathway
hahe00620  Pyruvate metabolism
hahe01100  Metabolic pathways
hahe01120  Microbial metabolism in diverse environments
hahe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hahe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ENC22_25720
Enzymes [BR:hahe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     ENC22_25720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M AlaDh_PNT_C Malate_DH ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AZZ94402
UniProt: A0A3T0VTC4
LinkDB All DBs
Position
complement(5825701..5826972)
Genome map
AA seq 423 aa AA seqDB search
MSDELKKAALEYHAQPRPGKLSVEITKPTATSRDLSLAYSPGVAEPVREIAKDAETAYRY
TNKGNLVAVISDGTAILGLGNLGPLASKPVMEGKGVLFKRFAGIDVFDIEVKAESPQAFI
DTVARIADTFGGINLEDIKAPECFEIERVLIEQCSIPVFHDDQHGTAIVTAAGMLNALEL
QGKQIGEAKIVCLGAGAAAVACMKLLISCGAKSENIYMIDRKGVIHSGRDDLNQYKAMFA
LDTDKRTLADACEGADVFVGLSGPDLLSVDMLKSMAPNPVIFACSNPDPEIKPELALAAR
DDLIMATGRSDYPNQVNNVLGFPFIFRGALDVRATAINEEMKVAAVNAIRELAKQPVPQD
VVDAYGGEKFEFGKNYIIPKPMDVRLLTEVCAAVARAAVDSGVARLPYPEHYPLNSIDDI
KIV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgagttgaaaaaagcggcgctggagtatcatgcacaaccgcgcccaggtaag
ttgagtgttgagattaccaaacctacggcgacttctcgtgatctgtccctggcttatagc
ccgggcgtagctgagcctgttcgcgaaatcgccaaagatgcggaaactgcatatcgctac
accaataaggggaatttggtcgcagtgatatctgatgggacggccattcttgggctgggt
aacttagggcctttggccagcaagccggtcatggaaggcaagggcgtactgttcaagcgt
tttgccgggatcgacgtttttgatatcgaagtcaaagcggagagccctcaggcgtttatc
gacacagtcgctcgcatcgcggataccttcgggggaatcaaccttgaagacatcaaagcg
ccagagtgctttgagattgaaagagtgctgattgagcaatgctctatccctgtattccat
gacgaccagcatggtacggccattgttactgcggcgggtatgctgaatgcgctggagttg
caaggcaaacagattggcgaagccaagattgtgtgtctgggcgcaggcgctgcggcggtg
gcctgtatgaagcttttgattagctgcggcgcgaaatcggaaaatatctatatgattgac
cgtaaaggcgttattcatagtggccgtgatgaccttaaccagtataaggctatgtttgct
ctggataccgataagcgtactctggctgacgcttgcgaaggcgctgacgtatttgtgggc
ctctcaggtccagatttgctttcagtagatatgctgaagagcatggctccgaatcctgtg
attttcgcttgttctaatcctgatcctgaaatcaagcctgagctggcgctggcggcccgt
gatgatttaatcatggcgacagggcgttccgattatccgaaccaggttaataacgtactg
ggcttccctttcattttccgtggcgctcttgatgtccgcgcgactgctattaatgaagag
atgaaagtcgcagcagtgaacgctatccgtgaactggccaaacaacctgtaccacaggat
gttgttgacgcatatggcggcgaaaagtttgagtttggcaagaactatattatccccaaa
cctatggatgttcgcctgctgaccgaagtatgtgcggctgtcgccagagcggcggttgac
tcaggtgtggctcgtttgccttaccccgagcactacccattgaactcaattgatgatatt
aaaatcgtgtga

DBGET integrated database retrieval system