KEGG   Hahella sp. KA22: ENC22_28625Help
Entry
ENC22_28625       CDS       T05793                                 

Definition
(GenBank) leucine-rich repeat domain-containing protein
Organism
hahe  Hahella sp. KA22
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRR_9
Motif
Other DBs
NCBI-ProteinID: AZZ94945
UniProt: A0A3T0VUU5
LinkDB All DBs
Position
complement(6432211..6433131)
Genome map
AA seq 306 aa AA seqDB search
MNNRIISINNEKLDSFPVIEDYASLRELSLNGNRISAIPHSIGSAAELKKFSVFDNQIAE
IVPEIWSLTQLEDLNVSKNQLEAVSSEIGNLTKLKIIDIAHNRLSEMPGSIAHCGDVEFL
YASNNKVAALPGSLKQLDKLLYLNLSDNPLTALPDDFSFESLVEFRLYNSGLVALPDSFF
LSRTLKEVYLQNNRLTELPKTIGRSTKLRKLFLEGNQITALPDEIGGCASLEELDLRNNP
IEQLPDSIGELKQLRLLDLRKNRLETLPESILSLENLCKLDLRWSERLQEPEWLDELRAR
GCLVYC
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgaataacaggattatttcaataaacaacgagaagctggattcgtttccggtcattgag
gattacgcttctcttcgtgagttgtctttgaacggcaaccgcatcagcgctattccgcac
agtatcggaagtgcggcggaactgaaaaaattcagtgtcttcgataaccagatcgcggag
attgtccctgaaatctggagtctgactcagctggaagatttgaacgtcagtaaaaatcag
ctggaagcggtgtccagtgagattggcaatctgaccaagttgaagattatcgatatcgcg
cacaacaggttgagtgagatgcctggctcgattgcacactgtggtgacgtagagttttta
tacgccagcaacaacaaagttgccgcgctgccaggctctctgaagcagttggataaattg
ctctaccttaatctgagcgataacccgctgacggcgttgccggatgatttcagttttgag
tcattggtggagttcaggttgtataacagcggtcttgtcgccttgccggattccttcttt
ctgtcccgaacgctgaaagaagtgtatctccagaacaatcgtctgactgaactgcccaaa
acgattggtcgctcaaccaaactgcgtaagttatttctggagggcaaccagattacggcg
ttgccagatgaaatcgggggctgcgcgtcattggaagagttggacctgcgtaataatcct
atcgagcaactgccagactccatcggtgagctgaaacaactgcgcctgctggacctcaga
aaaaatcgtcttgagacgctgcctgagtcgatcctgtcgttggagaacctctgcaaactg
gacctgcgctggtccgagcggctgcaagagccggaatggctcgatgaacttagagcccga
ggctgcttggtttactgctag

DBGET integrated database retrieval system