KEGG   Hipposideros armiger (great roundleaf bat): 109371167
Entry
109371167         CDS       T04661                                 

Gene name
CXCL10
Definition
(RefSeq) C-X-C motif chemokine ligand 10
  KO
K12671  C-X-C motif chemokine 10
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04061  Viral protein interaction with cytokine and cytokine receptor
hai04062  Chemokine signaling pathway
hai04620  Toll-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04657  IL-17 signaling pathway
hai04668  TNF signaling pathway
hai05160  Hepatitis C
hai05164  Influenza A
hai05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109371167 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109371167 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109371167 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109371167 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    109371167 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    109371167 (CXCL10)
   04657 IL-17 signaling pathway
    109371167 (CXCL10)
   04062 Chemokine signaling pathway
    109371167 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109371167 (CXCL10)
   05160 Hepatitis C
    109371167 (CXCL10)
   05169 Epstein-Barr virus infection
    109371167 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109371167 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109371167 (CXCL10)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Chemokines
   109371167 (CXCL10)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Chemokines
   109371167 (CXCL10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 109371167
NCBI-ProteinID: XP_019479041
LinkDB
Position
Un
AA seq 104 aa
MNQSAVLIFCLIILALSGTQGMPLSRTPRCTCIKISDQPVNPRSLEKLEMIPASQSCPRV
EIIATMKKNGEKRCLNPESKVIKNILKAISKERSKRSPRTQRKA
NT seq 315 nt   +upstreamnt  +downstreamnt
atgaaccaaagtgctgttcttattttctgccttatcattctggctctgagtggaactcaa
ggaatgcctctctctagaactccacgctgtacctgcatcaagattagtgatcaacctgtt
aatccaaggtccttagagaaacttgaaatgattcctgcaagtcaatcttgtccacgtgtt
gagatcattgccacaatgaaaaagaatggggagaaaagatgtctgaatccagagtctaag
gtcatcaagaatatactgaaagcaattagcaaggaaaggtctaaaagatctcctcgaaca
caaagaaaagcataa

DBGET integrated database retrieval system