KEGG   Hipposideros armiger (great roundleaf bat): 109371340
Entry
109371340         CDS       T04661                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7 like 1
  KO
K04490  transcription factor 7-like 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04310  Wnt signaling pathway
hai04390  Hippo signaling pathway
hai04520  Adherens junction
hai04916  Melanogenesis
hai04934  Cushing syndrome
hai05132  Salmonella infection
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05200  Pathways in cancer
hai05210  Colorectal cancer
hai05213  Endometrial cancer
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05221  Acute myeloid leukemia
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109371340 (TCF7L1)
   04390 Hippo signaling pathway
    109371340 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109371340 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109371340 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109371340 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109371340 (TCF7L1)
   05225 Hepatocellular carcinoma
    109371340 (TCF7L1)
   05226 Gastric cancer
    109371340 (TCF7L1)
   05216 Thyroid cancer
    109371340 (TCF7L1)
   05221 Acute myeloid leukemia
    109371340 (TCF7L1)
   05217 Basal cell carcinoma
    109371340 (TCF7L1)
   05215 Prostate cancer
    109371340 (TCF7L1)
   05213 Endometrial cancer
    109371340 (TCF7L1)
   05224 Breast cancer
    109371340 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109371340 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109371340 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109371340 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109371340 (TCF7L1)
   05165 Human papillomavirus infection
    109371340 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109371340 (TCF7L1)
Transcription factors [BR:hai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    109371340 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 109371340
NCBI-ProteinID: XP_019479336
LinkDB
Position
Un
AA seq 469 aa
MNVDPSADSTWVSPAWGEIMNISQAVSQYLQMKWPLLDVPSGSTVKDTRSPSPAHLSNKV
PVVQHPHHMHPLTPLITYSNDHFSPASPPTHLSPDIDPKTGIPRPPHPSELSPYYPLSPG
AVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMMAPAHPG
LPTSGIPHPAIVSPIVKQEPAPPSLSPAVNAKSPVSVKKEEEKKPHVKKPLNAFMLYMKE
MRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNY
GKKKKRKREKQLSQTQSQQQVPEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSP
ATPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAATSPGQMGSQP
PLLSRPLPLGSMPTALLTSPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgaatgtggatcccagtgcagactcaacgtgggtttcaccagcttggggggaaatcatg
aacatcagccaagcagtgtcccagtacctacagatgaaatggcctctcctcgatgtcccc
tccggcagcacagtcaaggacaccaggtcaccgtccccagcacacttgtctaataaagtt
cctgttgttcagcacccgcatcacatgcacccgttgacgcccctcatcacctacagcaac
gaccacttctcccctgcctcccctcccacacacctctccccagacattgatccaaagaca
ggaatcccccggccccctcacccatctgagctgtctccgtattacccactctcacccgga
gctgtcggacaaatcccccatcccctcggctggctcgtcccacagcaaggacagcccatg
tactcccttcctcctggtggtttccggcacccctacccagcgctcgccatgaacgcctca
atgtccagcctggtttccagtcggttctcccctcacatgatggctccggcccatcctggt
ctgcccacctcagggattccccaccccgccatcgtctcccccatcgtcaagcaggaaccg
gcaccccccagcctgagcccggctgtgaacgcgaaatcacctgtctcagtgaaaaaggag
gaagaaaagaaaccccacgtgaagaagcctcttaatgccttcatgttatatatgaaggag
atgagggccaaggtggtggctgagtgcaccctgaaggaaagtgcagccattaaccaaatc
ctgggaaggaagtggcacaacctgtctcgagaagaacaggccaagtactatgaactggcc
cggaaggagcggcagctgcactcccagctctacccaacctggtcagcccgggacaactac
ggtaagaaaaagaagaggaagagagaaaagcagctgtcgcagacacagtcccagcagcaa
gtcccagaggcagagggtgctctggcctccaaaagcaagaagccatgtgttcagtacctg
cccccggagaagccctgtgacagccctgcctcttcccatggcagcatgctggactcgccg
gctaccccctccgcagccttggcctcaccggctgcccctgcggcaacccactcggagcaa
gcccagcccctgtcgctcaccaccaagcccgagacccgagcccagctggcgctccactcg
gccgccttcctgtcagcgaaggctgcagccacgtcccctggccagatgggcagccagccc
ccgctcctgtcccggcccctcccccttgggtccatgcccacagctctgctgacttctccc
ccttccttcccagccacgctccatgcccaccaggccctcccagtactccaggcccagcct
ctttccttggtcactaagtctgcccactaa

KEGG   Hipposideros armiger (great roundleaf bat): 109379461
Entry
109379461         CDS       T04661                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04310  Wnt signaling pathway
hai04390  Hippo signaling pathway
hai04520  Adherens junction
hai04916  Melanogenesis
hai04934  Cushing syndrome
hai05132  Salmonella infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05200  Pathways in cancer
hai05210  Colorectal cancer
hai05213  Endometrial cancer
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05221  Acute myeloid leukemia
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109379461 (LEF1)
   04390 Hippo signaling pathway
    109379461 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109379461 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109379461 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109379461 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109379461 (LEF1)
   05225 Hepatocellular carcinoma
    109379461 (LEF1)
   05226 Gastric cancer
    109379461 (LEF1)
   05216 Thyroid cancer
    109379461 (LEF1)
   05221 Acute myeloid leukemia
    109379461 (LEF1)
   05217 Basal cell carcinoma
    109379461 (LEF1)
   05215 Prostate cancer
    109379461 (LEF1)
   05213 Endometrial cancer
    109379461 (LEF1)
   05224 Breast cancer
    109379461 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109379461 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109379461 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109379461 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109379461 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109379461 (LEF1)
Transcription factors [BR:hai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    109379461 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 109379461
NCBI-ProteinID: XP_019491556
LinkDB
Position
Un
AA seq 414 aa
MPQLSGAGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQASQESYHDKGREHADDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHAHTDGDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESASGGKRSSFPTCKAKAAAPGPLLEMEAC
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggcaggcggcggcggcgggggggacccggaactctgcgccaca
gatgagatgatccccttcaaggacgagggcgatccccagaaggagaagattttcgctgag
atcagtcaccccgaagaggaaggcgacttggccgacatcaagtcctccctggttaacgag
tccgaaatcatcccggctagcaacggacacgaggtggccagacaagcacaagcctctcag
gagtcctaccacgacaagggcagagaacatgctgatgacggaaagcatccagatggaggc
ctctacaacaagggaccctcctattcgagttattccgggtacataatgatgccaaatatg
aataatgacccatacatgtcaaatggatctctttctccgcccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatctcatgcagtccatcctctcacccccctcatcacttac
agcgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccggctcctgagatccctaccttttaccccctatct
ccgggtggtgttggacagattacccccccacttggctggcaaggtcagcctgtatatccc
atcacgggaggattcaggcaaccctacccatcctcactgtcagtcgacacttccatgtcc
aggttttcccatcacatgattcctggtcctcctggtccccacacaactggcatccctcat
ccagctattgtcacgcctcaggtcaaacaggaacacgcccacactgacggcgacctgatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaag
aagcctcttaatgcttttatgttatacatgaaagaaatgagagcaaatgtcgtggctgag
tgtactctgaaagaaagtgcagctatcaaccagattctaggcagaaggtggcatgccctg
tcccgcgaagagcaggctaaatattatgaattagcgcggaaggaaagacagctacatatg
cagctttatccaggctggtctgcaagagacaattacggtaagaaaaagaagaggaagaga
gagaaactacaggaatctgcatcaggtggaaaacgaagttcattcccaacgtgcaaagcc
aaggcagcggccccggggcctcttctggagatggaagcttgttga

KEGG   Hipposideros armiger (great roundleaf bat): 109382635
Entry
109382635         CDS       T04661                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 (T-cell specific, HMG-box)
  KO
K02620  transcription factor 7
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04310  Wnt signaling pathway
hai04390  Hippo signaling pathway
hai04520  Adherens junction
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04916  Melanogenesis
hai04934  Cushing syndrome
hai05132  Salmonella infection
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05200  Pathways in cancer
hai05210  Colorectal cancer
hai05213  Endometrial cancer
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05221  Acute myeloid leukemia
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109382635 (TCF7)
   04390 Hippo signaling pathway
    109382635 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109382635 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    109382635 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109382635 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109382635 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109382635 (TCF7)
   05225 Hepatocellular carcinoma
    109382635 (TCF7)
   05226 Gastric cancer
    109382635 (TCF7)
   05216 Thyroid cancer
    109382635 (TCF7)
   05221 Acute myeloid leukemia
    109382635 (TCF7)
   05217 Basal cell carcinoma
    109382635 (TCF7)
   05215 Prostate cancer
    109382635 (TCF7)
   05213 Endometrial cancer
    109382635 (TCF7)
   05224 Breast cancer
    109382635 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109382635 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109382635 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109382635 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109382635 (TCF7)
   05165 Human papillomavirus infection
    109382635 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109382635 (TCF7)
Transcription factors [BR:hai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    109382635 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NPIP
Other DBs
NCBI-GeneID: 109382635
NCBI-ProteinID: XP_019497818
LinkDB
Position
Un
AA seq 418 aa
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDNAAGPERDLAELKSSLVNESE
GATGGAGVPGAGAGARGETEVGAEALGREHTSQRLFPDKLPEPLQDGLKAPECASGMYKD
TVYSAFNLLMHYPPPSGAGQHPQPQPPLHNKASQPAHGVPQLSPLYEHFSSPHPTSAPAD
INQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAAP
GAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPYDRSLKTQAEAKAEKEAKK
PTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKER
QLHMQLYPGWSARDNYGKKKRRSREKHQESNTGGKRNAFGTYPEKAAAPAPFLPMTVL
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggcggcgcgggcggcggcgacgacctcggcgcgcct
gacgagctgctggccttccaggacgagggcgaggagcaggacgacaagagccgcgacaac
gccgcgggccccgagcgcgacctggccgagctcaagtcgtcgctggtcaatgagtccgag
ggcgcgaccggcggcgctggggtcccgggggccggcgctggggcccgcggcgagaccgag
gtcggggcggaggcgctcgggcgggaacacacttcgcagagacttttccccgacaaactt
ccagaacctctgcaggacggcctgaaggccccggagtgcgccagcggcatgtacaaagac
accgtctactctgccttcaatctgctcatgcactacccacccccctccggagcagggcag
cacccccagccgcaacccccactgcacaacaaggccagtcagcccgcccatggcgttccc
caactctctcctctctacgagcatttcagcagcccacaccccacatctgcaccggctgat
atcaaccagaagcaagttcacaggcctctgcagactcctgacctctctggcttctactct
ctgacctcaggcagcatgggacagctcccccacactgtgagctggcccagccctcctctc
taccccctgtccccttcctgcggatatagacagcacttccctgcccccactgcagcccct
ggcgccccctaccccaggttcacccacccatccctgatgctaggttctggcgtacctggt
caccctgcggccatcccccacccggccattgtgcctccctcagggaagcaggagctgcaa
ccctatgatcgcagcctgaagacacaggcagaagccaaggcagagaaggaagccaagaag
ccaaccatcaagaagccgctcaatgccttcatgctgtacatgaaggagatgagagccaag
gtcattgcagagtgcacgctcaaggagagtgctgccatcaaccagatcctgggccgcagg
tggcacgcactgtcgcgggaagaacaggccaagtattatgagctggcccgcaaggagagg
cagctgcacatgcagctatacccaggctggtcggcgcgggacaactatgggaagaagaag
aggcggtccagggaaaagcaccaagaatccaacacaggaggaaaaagaaatgcattcggt
acttacccggagaaggccgctgccccagccccgttccttccgatgacagtgctctag

KEGG   Hipposideros armiger (great roundleaf bat): 109384898
Entry
109384898         CDS       T04661                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7 like 2
  KO
K04491  transcription factor 7-like 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04310  Wnt signaling pathway
hai04390  Hippo signaling pathway
hai04520  Adherens junction
hai04916  Melanogenesis
hai04934  Cushing syndrome
hai05132  Salmonella infection
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05200  Pathways in cancer
hai05210  Colorectal cancer
hai05213  Endometrial cancer
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05221  Acute myeloid leukemia
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109384898 (TCF7L2)
   04390 Hippo signaling pathway
    109384898 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109384898 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109384898 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109384898 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109384898 (TCF7L2)
   05225 Hepatocellular carcinoma
    109384898 (TCF7L2)
   05226 Gastric cancer
    109384898 (TCF7L2)
   05216 Thyroid cancer
    109384898 (TCF7L2)
   05221 Acute myeloid leukemia
    109384898 (TCF7L2)
   05217 Basal cell carcinoma
    109384898 (TCF7L2)
   05215 Prostate cancer
    109384898 (TCF7L2)
   05213 Endometrial cancer
    109384898 (TCF7L2)
   05224 Breast cancer
    109384898 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109384898 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109384898 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109384898 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109384898 (TCF7L2)
   05165 Human papillomavirus infection
    109384898 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109384898 (TCF7L2)
Transcription factors [BR:hai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    109384898 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 109384898
NCBI-ProteinID: XP_019502140
LinkDB
Position
Un
AA seq 674 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGTLQSRQALKDARSPSP
AHIVQCPLPCCTQGHDCQHLYPPSDFTVSTQVFRDMKRNHSLQKVGEPWCLESNKVPVVQ
HPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQ
IPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPPHMVPPHHTLHTT
GIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAK
VVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKK
KRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCV
RYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLA
MMPPPPALLLAEAAHGKAPALCPNGALDLPPAALQPPIMPSSSIAQPSTSSLHSHNSVAG
TQPQPLSLVTKSLE
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgaacaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagttcctcc
gattccgaggcggaaagacggcctccgccgcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccgggagcacacattactctgcgtac
aaaacgattgaacaccagattgcaattcagtatctgcagatgaaatggccactgcttgat
gtccaggcggggaccctccagagcagacaagccctcaaggatgcccgctctccatcacca
gcacacattgtgcagtgccccctcccttgctgcactcagggacatgactgtcagcacctc
taccccccctcagacttcactgtcagcactcaagtcttcagggacatgaaaaggaaccac
tccttacaaaaggttggggagccctggtgtttggagtcgaacaaagtgccggttgtgcag
caccctcaccatgtccaccctctcacgcctcttatcacgtacagcaatgagcacttcacc
ccaggaaacccacctccacacttaccagctgacgtagaccccaaaacaggaatcccaaga
cctccgcaccctccagatatatctccgtattacccactgtctcccggcaccgtaggacaa
atcccccatccgctaggatggttagtaccacagcaaggtcagccagtgtacccaattacg
acaggaggattccgtcacccctaccccacagccctgactgtcaacgcttccatgtccagc
tttctgtcttctaggttccctccccatatggtcccaccacatcatactctacatacgacc
ggcatcccccatccggccatagtcacaccaacagtcaaacaggaatcctcccagagtgac
gtcggctcgctccacagctcaaagcatcaggactccaaaaaggaagaagaaaagaagaag
ccccacataaagaaacctcttaacgcgttcatgttgtatatgaaggaaatgagagcgaag
gtcgtcgccgagtgcacattgaaagaaagcgcagccatcaaccagatcctggggcgaagg
tggcacgcactctctagagaagaacaagcaaaatactacgaactggcccggaaggagcga
cagcttcacatgcagctgtaccctggctggtccgcacgggataactacgggaagaagaag
aagaggaaaagggacaagcagccgggagagaccaatgaacacagcgaatgtttcctaaat
ccttgcctttcacttcctccgattacagacctgagcgctcctaagaaatgccgagcgcgc
tttggccttgatcaacagaataactggtgcggcccttgcaggagaaaaaaaaagtgcgtt
cgctacatacaaggtgaaggcagctgcctcagtccaccctcttcagatggaagcttacta
gactcgccgcctccctctcccaacctgctaggctcccctccccaagatgcgaagtcacag
actgagcagacccagcctctctcgctgtccctgaagcccgaccccttggcccaccttgcc
atgatgcctccgccgcccgccctcctgcttgccgaggccgcccatggcaaggcccccgcc
ctctgtcccaacggggccctggacctgcctcccgccgctttgcagccgcccatcatgccc
tcctcatctattgcacagccgtcaacatcttccttacattcccacaactccgtggccggg
acccaaccccagccgctctccctcgtaaccaagtctttagaatag

DBGET integrated database retrieval system