KEGG   Hipposideros armiger (great roundleaf bat): 109371489Help
Entry
109371489         CDS       T04661                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04020  Calcium signaling pathway
hai04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109371489 (CACNA1E)
   04020 Calcium signaling pathway
    109371489 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109371489 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hai04040]
    109371489 (CACNA1E)
Ion channels [BR:hai04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109371489 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 109371489
NCBI-ProteinID: XP_019479588
LinkDB All DBs
Position
Un
AA seq 2444 aa AA seqDB search
MVPEMRGLSPGRRLPEPTPCPAAGGSPEPRPAGPRCHHVLALPEEEAWRPQQYTALLEAD
ASEEAGMLPASPRTAAASGFDNFFPVQEGEGPGWEGSSSPFLPVSPEVMKRRRGGLIEQR
DIIKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAA
AYKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILA
TIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLR
NGWNVMDFIVVLAGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKA
MVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFTNNSGILEGFDPPHPCGVQGCPAGY
ECKDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIII
GSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDRAEEVMLAE
ENKNSGTSALEEGSLFCSLISSLYFSPVGTPLARASIKSAKVDGASYFRHKERLLRISVR
HMVKSQVFYWIVLSLVALNTACVAIVHHNQPPWLTHLLYYAEFLFLGLFLLEMSLKMYGM
GPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLR
NLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTV
FQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQ
ELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERR
RRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRP
RPVEGLALGLEKCEEERISRGGSLKGDTGALSSALDNQKSPLSLGKREPPWLARPCHGNC
DPTQQEAGGGDSVVTFEDRARHRQSQRRSRHRRVRTEGKEPSSISRSRSASQERSLDDDV
AIDGEKDREPRGSHGGKEPTIQEEERAQDLRRTNSLMVPSGSGLAGSLDEADTPLVLPQP
ELEVGKDGTLTEQETEGSSDQALLGDVQLDMGRVISQSEPDLSCVTANTDKAATESTSIA
VAIPDVDPLVDSTVVHISNKTDGEASPLKEAAIKEEEEEEVEKKKQKKEKRETGKAMVPH
SSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFD
YVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRD
IKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQL
FKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVST
GEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQG
DKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIAL
NTIVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITV
IGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYV
CLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIML
SCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLT
RDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRL
VLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKM
LDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQE
IIANAKALPYLQQDPVSGLSGRSGYPAMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEV
SELKSVQSSNHGIYLPPDTQEHAGSGRASSMPRLTVDPQVATDSSSMRRSFSTIRDKRSN
SSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERK
HLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSMSDTS
TPRRSRRQLPAVPPKPRPLLSYSSLIRHAGSTSPPADGSEGGSPLTSQALESNDAAGLPE
ASSSRHTRQGQHPSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRANTISSA
PPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 7335 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccgagatgcgtggactgagcccaggccgcaggctgccggagcccacgccctgc
ccggctgcgggcgggagccctgagccccggcccgcgggaccccgctgccaccacgtgctg
gccctgcccgaggaggaggcatggcggccccagcagtacaccgccctgctcgaggccgac
gcctcggaggaggcgggcatgctgccggcctccccgcgcaccgctgctgcctccggcttc
gacaacttcttcccggtgcaagagggcgagggccctggctgggagggcagctccagcccc
ttcctccccgtaagccccgaggtgatgaagcggcggcgtgggggcctcatcgagcagcgc
gacatcatcaaggcccacgaggcgcacaagatgcaaagcaccccgcaggcccggcgcaag
gagtgggagatggctcgcttcggggaggcggtggtcggcaggccggggtcgggtgacgga
gactcggaccagagcaggaaccggcaaggaaccccggtgccggcctctggaccggcggcc
gcctacaagcagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattccc
gtccggcagaactgtttcaccgtcaacagatccctgttcatcttcggagaagataacatt
gtcaggaaatacgccaagaagctcatcgattggccgccgtttgagtacatgatcctggcc
accatcatcgccaactgcatcgtcttggccctggagcagcatcttcccgaggacgacaag
accccgatgtcccgcagactggagaagacagaaccatacttcattggaatcttttgcttt
gaagctgggatcaaaattgtggccctggggttcatcttccataagggctcgtacctccgc
aatggctggaatgtcatggacttcattgtggttctcgctggcatcctggccactgcagga
actcacttcaacacacacgtggacctgaggaccctccgggctgtgcgtgtcctgaggccc
ctgaagctcgtgtcagggatacctagcctgcagattgtgctgaagtccatcatgaaggcc
atggtgcctcttctgcaaatcggcctcctgctcttctttgccatcctgatgtttgccatc
atcggcttggagttctacagcgggaagttgcaccgcgcatgcttcacgaacaattcaggt
attctagaaggctttgacccccctcacccgtgtggcgtgcagggctgcccagctggttat
gaatgcaaggactggatcggccccaacgatgggatcacccagttcgataacatccttttt
gctgtgctgactgtcttccagtgcatcaccatggaagggtggaccaccgtgctgtacaat
accaatgatgccttaggagccacctggaattggctgtacttcatccccctcatcatcatt
ggctccttctttgttctcaacctagtcctgggagtgctttccggggaatttgccaaagag
agagagcgagtggagaaccggagagcgttcatgaaactgcgacgccagcagcagattgag
cgggaactgaacgggtaccgtgcctggatagacagagcagaggaagtcatgcttgctgaa
gaaaataaaaattctggaacgtcagccttagaagagggcagtctcttttgcagcctcatt
tcctctctttacttctcccctgtaggcacacctcttgcgcgagccagcatcaaaagtgca
aaggtggacggggcctcctacttccggcacaaggaaaggcttctgcgtatctccgtccgt
cacatggttaaatcccaggtgttttactggattgtgctgagcctggtggctctcaacacc
gcctgtgtggccatcgtccaccacaaccagcccccgtggctcactcacctcctctactat
gcagaatttttgtttctgggactcttcctgttggagatgtccctgaagatgtacggcatg
gggccccgcctttattttcactcttctttcaactgctttgatttcggggtcaccgtgggc
agtatctttgaagtggtctgggcaatcttcagacctggtacatcttttgggatcagtgtc
ttgcgagctctccggcttctaagaatatttaaaataaccaagtactgggcatccctgcgg
aatctggtggtctccttaatgagttccatgaagtcgatcatcagtttgctcttccttctg
tttctcttcatcgtcgtctttgctctcctaggaatgcagctctttggaggcaggtttaac
tttaatgatggtactccttcggcaaactttgacaccttccctgcagccatcatgactgta
ttccagatcctgacgggtgaggactggaatgaggtgatgtacaacggcatccgctcccag
ggcggggtcagctctggcatgtggtccgctatctatttcatcgtgctcaccttgtttgga
aactacacgctgttgaacgtgttcttggccatcgccgtggacaacctggccaatgcccag
gagctgacgaaggatgagcaggaagaagaggaggccttcaaccagaagcatgcactgcag
aaggccaaggaggtcagcccgatgtctgcacccaacatgccttcaatcgaaagagacaga
aggagaagacaccacatgtcgatgtgggagccacgcagcagccacctgagggagcgaagg
cgccgacaccacatgtcggtgtgggagcagcgcaccagccagctgcggaggcacatgcag
atgtccagccaggaggccctcaacaaagaggaggccccgcccatgaacccactcaacccc
ctcaaccccctgagccccctgaacccgctcaatgctcatcccagcctttaccggagaccc
aggcctgttgaggggctggccctgggcctggagaaatgcgaggaggagcgcatcagccgt
ggggggtccctcaagggggacacaggggccctctcaagtgccctggacaaccagaagagc
cccttgtccctgggcaagcgggagccgccgtggctggccagaccatgtcatgggaactgt
gacccgacccagcaggaagctgggggcggggacagcgtggtgaccttcgaggaccgggcc
aggcacaggcagagtcagaggcgcagccggcaccgccgtgtcaggacggaaggcaaggag
ccctcctccatctcccggagcaggtctgccagccaggagcggagcctggatgacgatgtg
gccatcgatggggagaaggaccgcgagcccaggggcagccacgggggcaaggagcccacg
atccaggaggaagagagagcccaggacttaaggaggaccaacagtctgatggtgcccagt
ggctccgggctggcaggatcccttgatgaggcggacacacccctcgtcctgccccaacca
gagctggaagtggggaaggatgggaccctgacggagcaggagacagagggcagcagtgac
caagccctgctgggggacgtgcaactggacatgggcagggtcatcagccagagtgagcct
gacctctcctgcgtcacggccaatacggacaaggccgccaccgagagcaccagcatcgcc
gtcgccatccccgacgtggaccccttggtggactccaccgtagtgcacattagcaacaag
acggatggtgaagccagtcccttgaaggaggcggcgatcaaagaggaggaggaggaggaa
gtcgagaagaagaagcagaagaaggagaagcgtgagacaggcaaagccatggtgccccac
agctccatgttcatcttcagcaccaccaacccgatccgcagggcttgtcactacatagtg
aacctgcgctacttcgagatgtgcatcctcctggtgatcgcagccagcagcattgccctg
gcggccgaggaccccgtcctgaccaactcggagcgcaacaaagtcctgaggtattttgac
tacgttttcactggcgtgttcacctttgagatggttataaagatgatcgaccagggcttg
attctgcaggatgggtcctacttccgagacctgtggaacatcctagactttgtggtggtg
gttggtgcgctggtggccttcgctttggcgaacgctttgggaaccaacaaggggcgggac
atcaagaccatcaagtcgttgcgggtgctccgtgtgctgaggccactgaagaccatcaag
cgcttgcccaagctcaaggctgtcttcgattgcgtggtgacgtccttgaagaatgtcttc
aacatactcattgtctacaagctcttcatgttcatcttcgctgtcatcgcagtccagctt
ttcaaggggaagttcttttattgcacggacagttccaaggacaccgagaaggagtgcatt
ggcaactacgtggatcatgagaaaaacaagatggaggtgaaaggtcgggaatggaagcgc
cacgaatttcactacgacaacattatctgggccctgttgaccctcttcaccgtctccaca
ggagaaggatggcctcaagtcctgcagcactcggtcgatgtgaccgaggaagaccgaggc
ccgagccgcagcaaccgcatggagatgtccatcttttatgtggtctactttgtggtgttc
cctttcttctttgtcaatatctttgtggctctcatcatcatcaccttccaggagcaaggg
gacaagatgatggaggaatgcagcctggagaagaatgagagggcgtgtatcgacttcgcc
atcagtgccaagcccctcacccgctacatgccgcagaacaggcacaccttccagtaccgc
gtctggcacttcgtggtgtctccatccttcgagtacaccatcatggccatgatcgccttg
aacaccattgtgctgatgatgaagtactactccgctccctgcacttatgaactggccctc
aagtacctgaatatcgccttcaccatggtgttctccctggagtgtgtcctgaaggtcatc
gcatttggcttcttgaactatttccgagacacctggaatatctttgacttcatcacggtg
atcggcagtatcacggaaattattctgacagacagcaagctggtgaacaccagtggcttc
aacatgagctttctgaagctcttccgagccgcccgcctcatcaagcttctgcgtcagggc
tacaccattcgtattttactttggaccttcgtgcagtcctttaaggccctcccctatgtc
tgccttttgatcgccatgcttttcttcatctatgccatcattgggatgcaggtatttgga
aacataaaattggatgaggagagtcacattaaccggcacaacaacttccggagtttcttt
gggtccctcatgctactcttcaggagtgccacaggtgaagcctggcaggagataatgctg
tcgtgcctaggggagaaaggctgtgagccggataccacggcaccatccgggcagaacgag
aacgaacgctgcggcaccgacctggcctacgtttactttgtctccttcatcttcttctgt
tccttcttgatgctcaatctgtttgtggccgtcatcatggacaactttgagtacctgact
cgggactcgtccatcctggggcctcatcacctggatgagtttgtccgtgtctgggcagaa
tatgacagagctgcatgcggccgcatccattacactgagatgtatgaaatgctgactctc
atgtcaccaccgctaggcctcggcaagagatgtccctccaaagtggcatataagaggttg
gtcctgatgaatatgccagtagccgaggacatgaccgtccacttcacctccaccctaatg
gctctgatccggacagctctggacatcaaaattgccaaagggggtgctgacaggcagcag
ctcgactcggagctccagaaggagaccctggccatctggcctcacctgtcccagaagatg
ctggacctgcttgtgcccatgcccaaagcctctgacctgactgtgggcaaaatctatgca
gccatgatgatcatggactactataaacagagtaaggtgaagaagcagagacagcagctg
gaggaacagaaaaatgcacccatgttccagcgcatggagccctcctctctgcctcaggag
atcatcgccaatgccaaagccctgccttacctccagcaggaccccgtttcaggcctgagt
ggccggagtggataccctgcgatgagtccgctctccccccaggaaatattccagttggct
tgtatggacccagccgatgatggacagttccaggagcagcagtctctggagccagaggtt
agtgaattaaaaagcgtgcagtcctctaaccatggcatctaccttcctccggacacccag
gagcatgcgggatctgggagggcatcctctatgccacgcctgactgtggatccccaggtg
gcaacagactccagctccatgagacgttcattttccactattcgggataagcgttccaat
tcctcatggttggaggaattctccatggagcgaagcagtgaaaacacttacaagtcacgt
cgccggagttaccactcctccctgcggctgtcagcccatcgcctgaactcggactcaggc
cacaagtccgacacgcaccgctcagggggcagagaacgaggacgatcgaaagagcgaaag
catcttctctcccccgatgtctcccgctgcaactcagaggagagagggacccaggccgac
tgggagtccccagagcgccgtcagtccaggtctcccagtgagggcaggtcacagaccccc
aacagacagggcacaggctccttgagtgaaagctccatcccctccatgtctgacaccagc
accccaagaagaagtcgtcggcagctccccgcagtccctccaaagcctcggcccctcctt
tcctacagctccctgattcgacatgcggggagcacctctcccccagccgatggaagtgag
ggcggctccccgttgacctcccaagccctggagagcaatgacgctgctggcttgcccgag
gcttccagctcccggcacacacggcagggccagcacccttccccacagcgctacatctcc
gagccctacctggccctgcacgaagactcccacgcctcagactgtggcgaggaggagacg
ctcaccttcgaagcagccgtggccaccagcctgggccgtgccaacaccatcagctcagcc
ccgcccctgcggcacagctggcagatgcccaatgggcactatcggcggcggcggcgtggg
gggccggggccaggcatgatgtgtggagctgtcagcgacctcctgagtgacacggaagaa
gatgacaaatgctag

DBGET integrated database retrieval system