KEGG   Hipposideros armiger (great roundleaf bat): 109371521
Entry
109371521         CDS       T04661                                 

Gene name
DDX58
Definition
(RefSeq) DExD/H-box helicase 58
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:3.6.4.13]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04064  NF-kappa B signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109371521 (DDX58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109371521 (DDX58)
   04623 Cytosolic DNA-sensing pathway
    109371521 (DDX58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109371521 (DDX58)
   05164 Influenza A
    109371521 (DDX58)
   05161 Hepatitis B
    109371521 (DDX58)
   05160 Hepatitis C
    109371521 (DDX58)
   05168 Herpes simplex virus 1 infection
    109371521 (DDX58)
   05169 Epstein-Barr virus infection
    109371521 (DDX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hai04054]
    109371521 (DDX58)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109371521 (DDX58)
Pattern recognition receptors [BR:hai04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   109371521 (DDX58)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD ResIII Helicase_C DEAD AAA_22 AAA_25 CCDC85 ATP-synt_ab
Other DBs
NCBI-GeneID: 109371521
NCBI-ProteinID: XP_019479625
LinkDB
Position
Un
AA seq 929 aa
MTAEERRNLLAFQSYVTKILDPTYILSYMAPWFKEDELQCIQAEKNNKGAIEAASLFLKF
LLELQEEGWFRGFLDALHHAGYSGLYEAIESWDFQKIEKLEEYRLTLRRLQPEFKTSVHP
DNILPDISECLINQECEEIKQICSSKGPMAGAEKMAECLLRSDKENWPKTLKLALEKEEN
KFSELWIVDKGSKDVETKDLEDEDMKTSEVQIVYKEEPDCQNLSQNSCPPSEVSHSHSQI
KPRNYQLELTLPANQGKNTIICAPTGCGKTFVSLLICEHHLQKFPQGQKGKVVFFAIQLP
VYEQQKSVFSNYFERRGYNVSGISGETSENVSLQQIVENNDIIILTPQILVNSLKSGTIP
SLSVFTLMIFDECHNTSKHHPYNMIMFNYLDQKLGGSSDPLPQIIGLTASVGVGDAKTTA
EAMDYICKLCASLDISVVATVKDNLEELEDIVYKPQKFFRKVESRTTDRFKCIISQLMRE
IESLAKSIFGKLGTITLENLSEIQNRNFGTQKYEQWIVAVQKKCTVLQMPDKDEESRICK
ALFLYTSHLRKFNDALIINEHARMKDALDYLKDFFSNVRSAGFDEIEQDLTRRFEEKLQE
LESISMDPSNENPKLKDLCFILQEEYHLNPETRTILFVKTRALVDALKKWIEENPKLSFL
KPGILTGRGKTNQTIGMTLPAQKCALDEFRTNGDNKILIATSVADEGIDIAQCNLVILYE
YVGNVIKMIQTRGRGRAKGSKCFLLTSNADVIQKEKINIYKEKMMNDSILKLQTLDEKVF
KEKVHRIQIHEKFIRDSQGKAKPVLDKKNKKLLCRKCKAFACYTADIRVVEECHHTVIGD
AFRECFVSKLHPKAKKFGNFEKKAKIFCARENCRHDWGIHVKYKTFEIPVIKIESFVVED
IATGDQTLYAKWRDFHFEKLPFNPAEISK
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgacggctgaggagcggcggaacctgctcgcctttcagagctatgtcacgaagattctg
gaccctacctacatcctgagctacatggccccttggtttaaggaggatgagctgcagtgt
attcaggctgagaaaaacaacaagggtgcaatagaggctgcctcactttttcttaaattc
ctattggagctccaggaggaaggctggttccgtggctttttggatgctcttcaccatgcc
ggttattctggcctttatgaagccattgaaagttgggatttccaaaaaattgaaaagttg
gaggagtatagattgactttaaggcgtttgcaaccagaatttaaaacaagtgttcatcca
gataatatccttcctgatatatctgaatgtttaattaatcaagaatgtgaagaaattaaa
cagatatgttccagcaaggggccaatggcaggcgcagagaaaatggctgaatgccttctc
agatcagacaaggagaactggcccaaaactttgaaacttgctttggagaaagaagagaac
aagttcagtgaactgtggattgtagataaaggctccaaagatgttgaaacgaaagacctt
gaggatgaggacatgaaaacttctgaagtacagattgtctacaaggaagaaccagactgc
cagaatcttagtcagaattcctgtccaccttcagaagtgtctcattctcacagtcagata
aagccaaggaattaccaactagagctcactttgcctgctaatcaaggaaaaaacacaata
atatgtgctcctactggttgtgggaaaacctttgtttcacttcttatatgtgaacaccat
cttcagaaatttccacaaggacaaaaggggaaagttgtgttttttgctattcaactccca
gtgtacgaacagcagaaatccgtgttctcaaactattttgagagacgtgggtacaatgtt
tcaggcatttctggagaaacatctgagaatgtctcactgcaacagattgttgagaacaat
gacatcatcatcttaactccacagattcttgtgaacagccttaaaagtgggactattcca
tcactctctgtctttactttgatgatatttgatgaatgccacaacaccagtaaacaccat
ccttacaatatgatcatgtttaattatttggatcagaaacttggagggtcttcagaccca
ctgcctcagatcattgggctgactgcctcggttggtgtgggggatgccaaaaccacagct
gaagccatggactatatctgcaaactgtgtgcttctcttgacatatcagtggtagcaaca
gtcaaagacaacttggaggaactggaggatattgtttataagccccagaagtttttcagg
aaagtggaatcacggactaccgacagatttaaatgcatcatctctcagttaatgagggag
atcgagagtctggcaaagagtatctttggcaagcttggtaccataactctcgaaaactta
tctgaaattcaaaacaggaattttggaacacagaaatatgaacaatggattgttgcagtt
cagaaaaagtgcacggtgttacagatgccagacaaagatgaagagagcaggatttgtaaa
gcactgtttttgtatacttcacatttgcggaaatttaatgatgccctcattatcaacgag
catgcgcggatgaaagatgcactggattacttgaaagacttcttcagtaatgtccgatca
gcaggatttgatgagattgagcaagatcttactcggagatttgaagaaaagttgcaagaa
ctagaaagcatttccatggatcccagcaatgagaaccctaaactcaaagacctctgcttc
atcttgcaagaggagtaccacttaaacccagagactagaaccattctctttgtgaaaacc
agagcacttgtggatgctttaaagaaatggattgaagaaaatcctaaactcagctttcta
aaacctggcatattgactggacgtggcaaaacaaaccagaccataggaatgaccctccca
gcacagaagtgtgcattggatgaattcagaaccaatggcgataacaagattctgatcgcc
acctcagttgctgatgaaggcatcgacattgctcagtgcaatctggtcatcctgtatgag
tatgtgggcaatgtcatcaaaatgatccaaaccagaggcagagggagagcaaaaggtagc
aagtgcttccttctgactagtaatgctgatgtaattcaaaaagaaaaaataaacatatac
aaagaaaaaatgatgaatgactccattttaaagcttcagacactggatgaaaaagtattt
aaagaaaaggttcaccgtatacagattcatgaaaaattcatcagggatagtcaaggaaaa
gcgaaacctgtacttgataagaaaaataaaaaactgctctgcagaaagtgcaaagccttt
gcatgttatacagctgatataagagtggtggaggagtgccatcacactgtgattggagat
gctttcagagagtgctttgtgagtaaattacaccccaaagcaaagaagtttgggaatttt
gaaaagaaagcaaagatattctgtgccagagaaaactgccgccatgactggggcatccat
gtgaagtataagacgtttgagattccagttataaaaattgaaagttttgtggtggaagat
attgcaactggagatcagacactgtatgcaaagtggagggactttcattttgagaagcta
ccgtttaatcctgcagaaatatccaaatga

DBGET integrated database retrieval system