KEGG   Hipposideros armiger (great roundleaf bat): 109371673
Entry
109371673         CDS       T04661                                 

Gene name
TNFSF10
Definition
(RefSeq) tumor necrosis factor superfamily member 10
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04061  Viral protein interaction with cytokine and cytokine receptor
hai04068  FoxO signaling pathway
hai04210  Apoptosis
hai04217  Necroptosis
hai04650  Natural killer cell mediated cytotoxicity
hai05132  Salmonella infection
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109371673 (TNFSF10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109371673 (TNFSF10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109371673 (TNFSF10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109371673 (TNFSF10)
   04217 Necroptosis
    109371673 (TNFSF10)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109371673 (TNFSF10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109371673 (TNFSF10)
  09172 Infectious disease: viral
   05164 Influenza A
    109371673 (TNFSF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109371673 (TNFSF10)
   04052 Cytokines and growth factors [BR:hai04052]
    109371673 (TNFSF10)
   04090 CD molecules [BR:hai04090]
    109371673 (TNFSF10)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109371673 (TNFSF10)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Tumor necrosis fators
   109371673 (TNFSF10)
CD molecules [BR:hai04090]
 Proteins
  109371673 (TNFSF10)
SSDB
Motif
Pfam: TNF C1q
Other DBs
NCBI-GeneID: 109371673
NCBI-ProteinID: XP_019479875
LinkDB
Position
Un
AA seq 311 aa
MALWVTRTFASNILPSRLRSSRPDRTMASMPSSGGPSLGMTCVFVLIFTALLQSLCMAVT
YMYFSNQLKQMQDKYSKNGIACLLNEDDSSWDPSDEESLNNACWQVKWQLRKMILRTYEE
TISTVPEKQHIVANLPRDQVPQRVAAHITGTSRKRSLLPTPGSKTGKALGQKIHSWESSR
KGHSFLNNLHLRNGELVIQQTGLYFIYSQTYFRFQEPENILETVSREENRRKNKQMVQYI
YKVTSYPDPILLMKSARNSCWSKDSEYGLYSIYQGGMFELKENDKIFVSVTNEAMIDMDQ
EASFFGAFLIG
NT seq 936 nt   +upstreamnt  +downstreamnt
atggccctctgggttacaaggacttttgcaagcaacattctgcccagcagactccgcagc
agccgaccagacaggaccatggcttcaatgccgtcctcggggggccctagcctcgggatg
acctgcgtgttcgtgctgatctttacagctctcctgcagtccctctgcatggccgtgact
tacatgtatttcagcaaccagctgaagcagatgcaggacaagtactccaaaaatggcatt
gcttgtctcttaaatgaagatgacagctcttgggaccccagtgatgaagagagtctgaac
aacgcctgctggcaagtaaagtggcaactacgaaagatgattttgagaacctatgaggaa
accatttctacagttccagaaaaacaacacattgttgccaacctaccaagagaccaagta
cctcagagggtagcagctcacataactgggaccagccgaaaaagaagcctattaccaact
ccaggctccaagactggaaaagctttgggccagaaaatacactcctgggagtcatcacga
aaaggacattcattcttgaataatttgcacctgaggaatggagagctggttatccaacaa
acagggctttatttcatctattcccaaacatactttcgctttcaggaacctgagaacatt
ttggaaacagtttcaagagaagagaacagaaggaaaaacaaacaaatggtacaatatatt
tacaaagtcacaagctatcctgacccaatactgctgatgaaaagtgctagaaatagttgt
tggtctaaagattcagaatatggactctattctatctatcaaggtgggatgtttgagctt
aaagaaaatgacaaaatttttgtatctgtaactaatgaggcaatgattgacatggaccaa
gaagccagtttcttcggggcctttttaattggctaa

DBGET integrated database retrieval system