KEGG   Hipposideros armiger (great roundleaf bat): 109372148Help
Entry
109372148         CDS       T04661                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00010  Glycolysis / Gluconeogenesis
hai00051  Fructose and mannose metabolism
hai00052  Galactose metabolism
hai00500  Starch and sucrose metabolism
hai00520  Amino sugar and nucleotide sugar metabolism
hai00524  Neomycin, kanamycin and gentamicin biosynthesis
hai01100  Metabolic pathways
hai01200  Carbon metabolism
hai04066  HIF-1 signaling pathway
hai04910  Insulin signaling pathway
hai04930  Type II diabetes mellitus
hai04973  Carbohydrate digestion and absorption
hai05230  Central carbon metabolism in cancer
Module
hai_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hai_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109372148 (HK1)
   00051 Fructose and mannose metabolism
    109372148 (HK1)
   00052 Galactose metabolism
    109372148 (HK1)
   00500 Starch and sucrose metabolism
    109372148 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    109372148 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109372148 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    109372148 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109372148 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109372148 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    109372148 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    109372148 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109372148 (HK1)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109372148 (HK1)
Membrane trafficking [BR:hai04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109372148 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 UvrD-helicase CSD
Motif
Other DBs
NCBI-GeneID: 109372148
NCBI-ProteinID: XP_019480655
LinkDB All DBs
Position
Un
AA seq 993 aa AA seqDB search
MGAEEVGLLAAVTLPGTGARRLGVRELPPRHGPWGRSRGRRRRRSRRAATRGPLLAQAAE
DRRRPHACHPASPTASMIAAQLLAYYFTELKDDQIKKIDKYLYAMRLSDETLIDIMTRFK
KEMKNGLSRDFNPTATIKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQN
VLMESEMYDTPENIMHGSGSQLFDHVAECLGDFMEKKKIKDKKLPVGLTFSFPCRQSKID
EGILITWTKRFKVSGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHC
EVGIIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREIDRG
SLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTNDVSAIEK
NKEGLHNAKEILTRLGVEPSDDDCISVQHVCTLVSFRSANLVAATLGAILNRLRDNKGTP
RLRTTVGVDGSLYKTHPQYARRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLA
EQHRQIEETLAHFSLTKEMLLEVKKRMRTEMDMGLQKQTNDKAVVKMLPSFVRSTPDGTE
HGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISD
FLDYMGIKGPRMPLGFTFSFPCKQTSLDAGILITWTKGFKATDCVGNDVATLLRDAIKRR
EEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGNQGRMC
INMEWGAFGDNGCLDDIRTEYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKK
GFLFRGQISEPLKTRGIFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCG
VVSKRAAQLCGAGMAAVVDKIRENRGLNHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSP
KCNVSFLLSEDGSGKGAALITAVGVRLREETSS
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgaggaggtgggcctgctggcggctgtcaccctcccggggacgggagcgcgg
agattgggagtgcgcgagctgccgccgcgccacgggccgtgggggaggagccgcgggagg
aggaggaggaggagccgccgagcagctacccgaggaccactgctcgcccaggctgcggag
gaccgacgccggccccacgcctgccaccccgcgtccccgaccgcaagcatgatcgccgcg
cagctcctggcctattacttcactgagctgaaggatgaccaaatcaaaaagattgacaag
tatctctatgccatgcggctctctgatgaaactctgatagatatcatgactcgtttcaag
aaggagatgaagaatggtctttcccgggattttaatccgacagccacaatcaagatgttg
ccaacgtttgtaaggtccattcctgatggttcagaaaagggagatttcattgccctggat
cttggtgggtcttcctttcgaattctgcgggtccaagtgaatcatgagaagaaccagaat
gttctcatggagtctgagatgtatgacaccccggagaacatcatgcacggcagtggaagc
cagctctttgatcatgttgctgagtgcctgggagacttcatggagaaaaaaaaaatcaag
gacaagaaattacctgtgggacttacattttctttcccttgtcggcagtccaaaatcgac
gagggtatcctgatcacttggacaaagcgatttaaagtgagtggagtggagggagcggat
gtggtgaagctgcttaacaaggccatcaaaaagcgcggggattatgatgccaacattgtg
gctgtggtgaatgacacggtagggaccatgatgacctgtggctatgacgaccagcactgt
gaagtcggcatcatcattggcactggcaccaacgcgtgctacatggaggaactgaggcac
attgacctggtggaaggcgacgaggggaggatgtgcatcaacaccgagtggggggccttt
ggagacgacggtgccctggaggacatccgcaccgagtttgaccgggagatagaccgggga
tctctcaaccctggaaaacagctgtttgagaagatggtcagtggcatgtacctgggggag
ctggttcggctgatcctagtcaagatggccaaggagggccttttatttgaagggcgaatc
accccagagctgctcaccagagggaagtttaacactaatgatgtctcagccatcgaaaag
aataaagaaggcctccacaatgccaaagaaatcctgacccgcctgggagtggaaccatct
gatgacgactgtatttcggtccagcatgtgtgcacccttgtctcgtttcgctctgccaac
ctggtggcggcaacgctgggcgccatcttgaatcgtcttcgagataacaagggcaccccc
aggctgcggaccacggttggtgtcgacgggtctctttacaagacgcacccacagtacgcc
cggcgtttccacaagaccctgaggcgcttggtgcctgactctgatgtgcgtttcctcctc
tcggagagtggcagcggcaagggggctgccatggtgacggcggtggcataccgcctggca
gagcagcaccggcagatagaggagaccctggcccacttcagcctcaccaaggaaatgctg
ctggaggtgaagaagcggatgcggactgagatggacatggggctgcagaagcaaaccaat
gataaggccgtagtcaagatgctgccttcctttgtccggagtactccagacgggactgag
catggtgacttcttggctttggatcttggaggaacaaatttccgtgtcctgctggtgaaa
atccgtagtgggaaaaagagaacggtggaaatgcacaacaagatctatgccattcccatt
gaaatcatgcagggcactggggaagagctatttgaccacatcgtctcctgcatctctgat
ttcctggactacatggggatcaaaggccccagaatgcctctgggcttcacgttctcattt
ccctgcaagcagacaagtctggatgcgggaatcttgatcacttggacaaaggggtttaag
gccaccgactgcgtggggaacgatgtagccaccttactaagggacgcgataaaaaggaga
gaggaatttgacctggacgtggtagctgtggtcaatgacacggtgggcaccatgatgacc
tgtgcttatgaggagcccacctgtgaggttggactcatcgtaggaactggcagcaatgcc
tgctacatggaagagatgaagaatgtggagatgctggaggggaaccagggacggatgtgt
atcaatatggagtggggtgcctttggggacaacgggtgtctggatgatatcagaacagag
tatgaccgactggtggatgaatattctctaaatgctgggaagcaaaggtatgagaagatg
atcagtggcatgtacctgggtgagatcgtccgcaacatcttgattgacttcaccaagaag
ggattcctcttccgagggcagatctctgagccgctgaaaactcggggcatctttcagacc
aagtatctctctcagatagagagtgaccgattagcgctgctccaggtccgggccatcctc
cagcagctgggcctgaatagcacctgtgacgacagtatcctcgtcaagaccgtgtgcggg
gtggtgtccaagagggccgcgcagctgtgcggtgcaggcatggctgccgtggtggataag
atccgagagaacagagggctgaaccacctcaacgtgactgtgggggtggatggaacactc
tacaagcttcatccacacttctccagaatcatgcaccaaaccgtgaaggaactgtcacca
aagtgtaatgtgtccttcctcctgtcagaagacggtagtggcaagggggctgccctcatc
acggccgtgggcgtccggctccgagaagaaacaagcagctaa

DBGET integrated database retrieval system