KEGG   Hipposideros armiger (great roundleaf bat): 109372166Help
Entry
109372166         CDS       T04661                                 

Gene name
PROM1
Definition
(RefSeq) prominin 1
  KO
K06532  prominin 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    109372166 (PROM1)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109372166 (PROM1)
CD molecules [BR:hai04090]
 Proteins
  109372166 (PROM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prominin Tweety Reo_sigmaC Erp_C zf-C4_Topoisom DUF1664 Baculo_PEP_C TMPIT ApoLp-III T4SS CENP-F_leu_zip MCPsignal Phage_GP20 SF-assemblin ANAPC4 CENP-Q
Motif
Other DBs
NCBI-GeneID: 109372166
NCBI-ProteinID: XP_019480678
LinkDB All DBs
Position
Un
AA seq 856 aa AA seqDB search
MAPTLVFLLLLGLCWNTVSEGPPSSTRGSDVPEFELPTMNYDTKDSYKPGSIGVLFQIVH
TFLHVVQPNAFPEDILRKIIQKKFDLSTDYEKPENVVLTLKIIHYEIGIIICAVLGLLFV
ILMPLVGFCFGLCRCCNKCGGEMHQRQKKNGTFLRKCFAVSLLVICIFISIGIICGFVAN
HHLRTQVEKTRTLADSNFRDLRTLLNETPSQISYVLDQYTLIKEKAFSDLDNIKSLLGGG
IHEQLRPKVIPVLVDIKTMAEAIKETKEALLNVNNTLEELKKSTAQLNSSLSDIKTNLEQ
SLNDPQCSVPSMTATCNDIRKTLDHLDDNTSVDQLPSLHMQLDNVNDVLRTDLSSLVQKG
NKSFNDIPEMVQNQTTDMVSDIKSTLNSIGSDIKNINEQISIQDNLSIFMDPINSVETYI
HQKLPTLEEYDSYRWLASLVVCCLLSLIVIFYYLGLLCGVFGYDRHATPTRRGCVSNTGG
IFLMAGVGVSFLFCWILMTIVVLTFVVGGNVEKLVCEPYQNKKLFQILDTPYLLNENWKY
YLSGMVFNKPDINLTFEQVYSDCKENKGIYATLKLENHYNFSEHLNILEHTGNINSSFEN
MNVRIDNIVLLDAAGRKNLLDFSSSGVDQIDYEAYLAEIAKPPTKVNLLSFADELERKAS
QLPPGSLKQSLTSNAQTIRTLYHDQVMPLRQLMGSLYRRIQSLQHKSTGLGEKVANIITS
LDSAQDFITNRISSVIVQESKKYGNMILGYFERYLQWVKISITEQIAACKPVATALDSAV
DVFLCSYIIEPMNLFWFGIGKATIFLLPAIIFAVKLAKYYRRMDSEDVYDDVETVPMKNM
QKGHIGFHRHQTTQAL
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggccccgacactcgtcttcctgctgctgctggggctgtgttggaataccgtttcagag
gggccaccgtcatccacaaggggttctgatgttccggaatttgaactgccgacaatgaac
tatgacacgaaagactcgtataaacctggatccattggcgttctctttcaaattgtgcac
acctttctccatgtggtgcagcccaatgctttccctgaagatattttaaggaaaataata
caaaagaagtttgacctctcaactgattatgagaagccagaaaatgtagtcttgactctg
aagatcatccactatgagatcgggattattatctgtgctgtcctgggactgctttttgtt
attctgatgcctctggtggggttttgctttggtttgtgtcgttgctgtaacaagtgtggc
ggagaaatgcaccagcgacagaagaaaaatgggaccttcctgaggaaatgctttgcagtc
tctctcttggtgatttgtatatttataagcattggtatcatctgtggttttgtggcaaac
caccacctgaggacccaggttgaaaagactcggacactggcagacagtaatttcagagac
ttgagaactctcctgaatgaaactccatcgcaaatcagctatgtactggaccagtatact
ctcattaaggaaaaggcattttcagatctggacaatattaagtcattgctaggaggtggg
attcatgaacaactgagacctaaagtgatccccgttcttgttgacatcaagaccatggca
gaagcaatcaaagaaaccaaagaagccctgttgaacgtgaacaataccttagaggagctg
aaaaaatcaactgcacaacttaatagcagcctgagtgacattaaaacgaacctggagcaa
tcgctcaatgacccccagtgctctgtgccttcaatgacggccacttgtaatgacatcaga
aagactctagaccacctggatgacaacaccagtgtggatcagctcccatctttgcatatg
caacttgataatgttaatgatgttcttcgaactgatttgtccagcctggttcaaaagggc
aataaatcctttaatgatatacctgagatggtacaaaatcaaaccacagacatggtatca
gatatcaaaagtaccttgaattccattggttcagatatcaaaaatataaatgaacagatt
tctatccaggataatctgtcaattttcatggatcccattaattccgttgagacttacatc
caccaaaaattacccaccttggaagaatatgattcatacaggtggctggcgagcttggtt
gtgtgctgcttgctgtctctcatcgtgattttttattacctgggcttactgtgtggcgta
tttggctatgaccggcatgccaccccaacccgacgaggctgtgtctcaaacaccggaggt
atcttccttatggccggagttggagtcagtttcctcttttgttggatattgatgaccatt
gtggttcttacttttgttgttggtggaaatgtggaaaaattggtctgtgaaccttaccaa
aacaagaagttgttccagattttggacacaccatatttactaaatgagaattggaaatac
tatctctctggcatggtatttaacaaaccggatattaatctcacttttgaacaagtttac
agtgattgcaaagaaaataaaggtatttatgccacacttaagctggagaaccactacaat
tttagtgaacatctcaacattctagagcataccggaaacataaacagcagttttgaaaac
atgaacgtcaggattgacaatattgttctgctggacgcagcaggaagaaaaaaccttcta
gatttcagctcttcaggagtagaccaaatagattatgaggcttacttggccgagatagct
aaacctcccacaaaagtgaatcttttgtcatttgcagatgaactagaaagaaaagccagc
cagttgccccctggaagcttgaaacagtccctgacaagtaatgcacaaacgattagaaca
ctttaccatgaccaagtcatgcctttgagacaattgatgggaagtttataccgacgtatc
cagagtcttcaacacaaaagcactggattgggggaaaaagtggccaatatcattacttct
ttggattctgctcaggacttcatcacaaaccgtatttcctctgttattgttcaagaaagt
aagaagtatgggaatatgatacttggatattttgaacgttacctgcagtgggtcaagatc
tctatcaccgagcaaattgcagcctgcaaacctgtggccactgctttagattctgctgtt
gatgtcttcctgtgcagctacattatcgaacccatgaatctgttttggtttggcattgga
aaagctaccatatttttacttccggctatcatttttgctgtcaagttggccaagtactat
cgtcgaatggattcagaggatgtgtatgatgatgttgaaactgtacccatgaaaaatatg
caaaagggtcatattggctttcatagacatcaaaccactcaggctctatga

DBGET integrated database retrieval system