KEGG   Hipposideros armiger (great roundleaf bat): 109372325
Entry
109372325         CDS       T04661                                 

Gene name
TNFRSF10A
Definition
(RefSeq) TNF receptor superfamily member 10a
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04061  Viral protein interaction with cytokine and cytokine receptor
hai04115  p53 signaling pathway
hai04210  Apoptosis
hai04217  Necroptosis
hai04650  Natural killer cell mediated cytotoxicity
hai05132  Salmonella infection
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109372325 (TNFRSF10A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109372325 (TNFRSF10A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109372325 (TNFRSF10A)
   04217 Necroptosis
    109372325 (TNFRSF10A)
   04115 p53 signaling pathway
    109372325 (TNFRSF10A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109372325 (TNFRSF10A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109372325 (TNFRSF10A)
  09172 Infectious disease: viral
   05164 Influenza A
    109372325 (TNFRSF10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hai04050]
    109372325 (TNFRSF10A)
   04090 CD molecules [BR:hai04090]
    109372325 (TNFRSF10A)
Cytokine receptors [BR:hai04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109372325 (TNFRSF10A)
CD molecules [BR:hai04090]
 Proteins
  109372325 (TNFRSF10A)
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 109372325
NCBI-ProteinID: XP_019480952
LinkDB
Position
Un
AA seq 445 aa
MTTLPGPGALPDGTGQRGHSAWAPSGARALRSPAPVPARGARLRLWGPRAQIFVFALLMW
VLNASAVTTGQDRVHSQPAAPQGWKQGLSDKLCPPGFFLSEYSGDCAPCIWGKEFTNHSN
NLPSCQFCSDCGPGEEEKSPCTRTKDRECQCKPRTFLGKNSPEFCQPCSTRCPDGMVVAA
NCTPWSDLECVAQKSRNETNGEAAVPGEPATCPGPHNAPSPSSGSSQLLIGIVLGAVYVP
LLIITCAYYHRRRICQGCGVVTECTNRVIFRCLCPPRGPEGVDNARNEIVSSTGSLSTQA
SEQELGHQEHAELKDVFIQSPADAERLAFWNPGLLLVQDCGAGLKLFFDYFTSIVIFNSW
SVLKRLMASMTIICVARAQVSNPREALYEMLVTWLNNKGRAASVNTFLDALETLRERHTK
ELIQDHLVGSGKYVYKEDGAGSALS
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgacgaccctaccgggaccgggagcgctccccgacggcacggggcagcggggacacagc
gcgtgggccccctcgggcgcccgggccctgcggtctccagccccggtgccggcgcgggga
gccaggcttcggctctggggccccagggctcagattttcgtcttcgctctcctgatgtgg
gtcctcaatgcctcagccgtgaccacagggcaggacagagttcactctcaaccagctgcc
ccacagggatggaaacaaggcctctctgacaagttgtgtccaccaggattctttctatca
gaatacagtggagactgtgcaccgtgcatatgggggaaggaattcaccaatcattcgaac
aacctcccttcttgccaattctgttctgattgcggtccaggtgaagaggagaaaagtcca
tgcacccggaccaaagacagggagtgtcaatgcaaacctagaacgttccttgggaaaaat
tcccctgagttttgccagccgtgcagcactcggtgccctgatggcatggtcgtggcggcg
aactgtacaccctggagtgacctcgagtgtgtggcccaaaagtcaagaaatgaaaccaat
ggggaggcagcagttcctggagagccagcgacctgcccggggccgcacaacgctccctct
ccctcctcaggcagttcacagctgctgattggaattgtgctgggagctgtatatgtccca
ctgctgatcatcacatgtgcatattatcacaggaggcgcatctgtcaaggttgtggagtg
gtcactgagtgcacgaacagagtcattttccggtgcttatgtcccccaagagggcctgag
ggtgtggacaatgctcgcaacgagatcgtgagcagcacaggctcactgtccacgcaggcc
tctgagcaggaactgggacaccaggagcacgcagagctgaaagatgtcttcatacagtcc
ccagcggacgcagagcgtctggccttctggaaccctggccttctgcttgtccaggactgt
ggtgcaggcctgaagctgttctttgattacttcacaagcatcgtgattttcaattcctgg
agcgtgctcaagaggctaatggcctcaatgacaattatctgtgtggccagagctcaggtc
tcaaaccccagggaagccttgtatgaaatgctagtgacctggctcaacaacaaggggcgg
gctgcctcagtcaacaccttcctggatgccttggaaacactgagggagagacatacaaag
gagttgattcaggaccacctggtgggctctgggaagtatgtctacaaagaagatggggca
ggctctgctctgtcctga

KEGG   Hipposideros armiger (great roundleaf bat): 109389286
Entry
109389286         CDS       T04661                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10A-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04061  Viral protein interaction with cytokine and cytokine receptor
hai04115  p53 signaling pathway
hai04210  Apoptosis
hai04217  Necroptosis
hai04650  Natural killer cell mediated cytotoxicity
hai05132  Salmonella infection
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109389286
   04061 Viral protein interaction with cytokine and cytokine receptor
    109389286
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109389286
   04217 Necroptosis
    109389286
   04115 p53 signaling pathway
    109389286
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109389286
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109389286
  09172 Infectious disease: viral
   05164 Influenza A
    109389286
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hai04050]
    109389286
   04090 CD molecules [BR:hai04090]
    109389286
Cytokine receptors [BR:hai04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109389286
CD molecules [BR:hai04090]
 Proteins
  109389286
SSDB
Motif
Pfam: TNFR_c6 Death Cadherin_C_2 SCIMP gpUL132 CoV_E EphA2_TM Hum_adeno_E3A RCR TMEM154
Other DBs
NCBI-GeneID: 109389286
NCBI-ProteinID: XP_019510214
LinkDB
Position
Un
AA seq 440 aa
MSVWLPLLLLVPASVTAATSVTRCGSDKYELKSLGLCCPLCPAGQHVNKHCDGTQSTQCS
QCEPGTFTAHPNSETSCLPCAQCRDDQEEVTSCSPTRDRQCQCKTGSYYCDSGDCVEMCY
RCTRCERATLHPCNATRDATCAAETSPVPGNPNEDCLIPLHLWVFVVIGTLIFVSMVVII
VVVIICCCRRRRMQLWQPVANFLKKERSEPGSHSYNSSLPNEVLPPTDPKRHPAALGVNS
PLLYEGPALATEARTPPGPSEDPEDGTELQVVVTGGSDTAPEQASQAHAPVLQAHACGPQ
GQAEAXASLRCLQQEYERKYYLKDTSCDATNRIYYEFGHKVPESHWKMLMRFVGLEDNDI
EICEHEDPGNLMEQHHKMLLRWRNKLGREASVFTLVAALQQTELYVYLQNIVNKLVADNI
FGRHAEKPTRVNSSLARDYD
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgtcggtgtggctgccgctgctgctgcttgtcccggcctcggtgaccgccgcgaccagt
gtgacccggtgtggctcagacaagtatgagctaaagagccttggcctgtgctgccccctg
tgcccggcaggccagcacgtcaacaaacattgtgacgggacccagtccacacagtgcagc
cagtgtgagcctggcaccttcacggcccatcccaacagtgagaccagctgcctgccgtgt
gctcagtgccgggacgatcaggaggaggtgacttcgtgctccccgaccagggaccggcag
tgccagtgcaagacagggtcctactactgtgactcaggggactgtgtggagatgtgctac
cgctgtaccaggtgtgaacgtgccacccttcatccgtgcaatgccacacgggatgccacc
tgtgctgcagaaacgagcccagtgccaggaaacccaaacgaggactgcctcatccctttg
catctgtgggtgttcgttgtcatcggcactctcatctttgtcagcatggttgtcatcatt
gttgttgtcatcatctgttgctgtagaagacgacgtatgcagctttggcagccggttgcc
aatttcttgaaaaaagagcggagtgagccaggcagccattcatataactccagccttccc
aatgaggtgttgccacccacggaccccaagaggcacccagcagcacttggtgtgaactca
cctctgttgtacgagggcccagctttggcaacggaggccagaaccccaccagggccctct
gaggaccccgaggatggaactgagctgcaggtggtggtgactggaggaagtgacacagcc
ccagagcaggcatcacaagctcatgctcccgtgttacaagctcatgcctgtgggccccag
ggccaggccgaggcataagcctccctccgttgtctgcagcaggaatatgaacgtaaatat
tatttgaaggacacgtcctgcgatgccaccaataggatctattatgaattcggacataag
gttccagaaagtcactggaagatgctgatgagatttgtcggacttgaggacaatgacatt
gagatttgcgaacacgaggatcccggcaatttgatggaacagcatcataagatgctgctg
aggtggagaaacaagctcggaagggaagcgtctgtgtttacactcgtggctgccctccag
caaacggagctatatgtgtatttgcagaatattgtaaacaaattggttgctgataatatc
ttcggtagacatgccgagaaaccaactagagtaaactcttcgttggctcgggattatgac
taa

DBGET integrated database retrieval system