KEGG   Hipposideros armiger (great roundleaf bat): 109372520Help
Entry
109372520         CDS       T04661                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00010  Glycolysis / Gluconeogenesis
hai00030  Pentose phosphate pathway
hai00051  Fructose and mannose metabolism
hai00052  Galactose metabolism
hai01100  Metabolic pathways
hai01200  Carbon metabolism
hai01230  Biosynthesis of amino acids
hai03018  RNA degradation
hai04152  AMPK signaling pathway
hai05230  Central carbon metabolism in cancer
Module
hai_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109372520 (PFKM)
   00030 Pentose phosphate pathway
    109372520 (PFKM)
   00051 Fructose and mannose metabolism
    109372520 (PFKM)
   00052 Galactose metabolism
    109372520 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    109372520 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    109372520 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    109372520 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hai01009]
    109372520 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109372520 (PFKM)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     109372520 (PFKM)
Protein phosphatases and associated proteins [BR:hai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109372520 (PFKM)
Messenger RNA biogenesis [BR:hai03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     109372520 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 109372520
NCBI-ProteinID: XP_019481388
LinkDB All DBs
Position
Un
AA seq 780 aa AA seqDB search
MTHEEHHAARTLGVGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGNHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKLGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITAEEAMKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
DHLCRRLSETRTRGSRLNIIIVAEGAIDKQGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMNEKKFEEAMKLRGRSFMNNWEVYKLLAHVRPPVSKTGLHTVAVMNVGAPAAGMNAAVR
STVRIGLILGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWIGQGGSKLGTKRTLPKKSLEQ
ISANITKFNIQGLIIIGGFEAYTGGLELMDGRKQYDELCIPFVIIPATVSNNVPGSDFSV
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEAF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMTGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGEAPV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcatcatgcagccagaaccctgggggtcggcaaggccatcgccgtg
ttaacctctggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatttttactggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggat
ggtgggaaccacatccgggaagccacctgggagagcgtttcaatgatgcttcagctggga
ggcacggtgattggaagtgcccggtgcaaggacttccgggaacgagagggacgactccga
gctgcctacaaccttgtgaaacttgggatcaccaatctgtgtgtcattggtggcgatggc
agcctcactggggccgacaccttccgttctgagtggagcgacttgttgagtgacctccag
aaagcaggtaagatcacggctgaggaggctatgaagtccagctacctgaacatcgtgggc
ctggttggctcaattgacaatgacttttgtggcaccgatatgaccattggcactgactct
gccctgcatcggatcatagagattgtagatgccatcactaccactgctcagagccaccag
cggacgtttgtgctagaagtgatgggccggcactgtggatacctggcccttgtcacttct
ctctcctgtggtgccgactgggtttttattcctgaatgtccaccagatgatgactgggag
gaccatctttgtcgccggctcagcgagacaaggacccgtggttctcgtctcaacatcatc
attgtggctgagggtgcgatcgacaagcaagggaaaccaatcacctcagaagacatcaag
aatctggtggtaaagcgtctgggctatgacacccgggtcactgtcttggggcatgtgcag
cggggtgggacaccgtctgccttcgaccgaatcctgggcagcaggatgggtgtggaagca
gtgatggcacttttggaggggaccccagataccccagcctgtgtagtgagcctctctggt
aaccaggctgtgcgcctgcccctcatggagtgtgtccaggtgaccaaagacgtgaccaag
gccatgaatgagaagaaatttgaggaagccatgaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctggctcacgtcagacccccagtatctaagactggcttg
cacacggtggccgtgatgaatgtgggggccccggctgcaggcatgaatgctgccgtccgc
tccactgtgagaattggcctcatactgggcaaccgagtcctggttgtgcatgacggcttc
gagggtctggccaagggtcagattgaggaagctggctggagctatgttgggggctggatt
ggccaaggtggttctaaacttgggactaaaaggactctgcccaagaagagcttagaacag
atcagtgccaacatcactaagtttaatattcaaggccttatcatcatcgggggctttgag
gcatacactgggggcctggaactgatggatggcaggaagcagtatgacgagctctgcatc
ccatttgtcatcattcccgcgacggtctccaacaacgtccctggctcagacttcagcgtg
ggggccgacactgcactcaacaccatctgcacgacctgtgaccgcatcaagcagtcagct
gcaggcaccaagcgtcgggtgtttatcattgaaactatgggcggctactgtggctacctg
gccaccatggcaggactggcagctggggccgatgctgcctacatttttgaggaggccttc
accattcgagacctgcaggcgaatgttgaacatctggtgcaaaagatgaaaacaactgtg
aaaaggggcttggtgttaaggaatgagaagtgcaatgagaactataccactgacttcatt
ttcaacctgtactctgaggagggaaagggcatcttcgacagcaggaagaacgtgcttggc
cacatgcagcagggtgggagcccaactccatttgataggaactttgccactaagatgggc
gccaaggctatgaactggatgaccgggaaaatcaaagagagttaccgtaatggtcggatc
tttgccaacacaccagactcgggctgtgttctgggcatgcgtaagagggccctggtattt
caaccagtgactgagctaaaggaccagacagattttgagcaccgtatccccaaggaacag
tggtggctgaagctgagacccatcctcaaaatcctagccaagtatgagatcgacttggat
acctcagagcacgctcacctggagcacatcagtcggaagcggtctggagaagctcctgtc
taa

DBGET integrated database retrieval system