KEGG   Hipposideros armiger (great roundleaf bat): 109372542
Entry
109372542         CDS       T04661                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04012  ErbB signaling pathway
hai04020  Calcium signaling pathway
hai04024  cAMP signaling pathway
hai04066  HIF-1 signaling pathway
hai04114  Oocyte meiosis
hai04217  Necroptosis
hai04261  Adrenergic signaling in cardiomyocytes
hai04310  Wnt signaling pathway
hai04360  Axon guidance
hai04713  Circadian entrainment
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04728  Dopaminergic synapse
hai04740  Olfactory transduction
hai04750  Inflammatory mediator regulation of TRP channels
hai04911  Insulin secretion
hai04912  GnRH signaling pathway
hai04916  Melanogenesis
hai04921  Oxytocin signaling pathway
hai04922  Glucagon signaling pathway
hai04925  Aldosterone synthesis and secretion
hai04934  Cushing syndrome
hai04971  Gastric acid secretion
hai05012  Parkinson disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05031  Amphetamine addiction
hai05152  Tuberculosis
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05214  Glioma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109372542 (CAMK2G)
   04310 Wnt signaling pathway
    109372542 (CAMK2G)
   04066 HIF-1 signaling pathway
    109372542 (CAMK2G)
   04020 Calcium signaling pathway
    109372542 (CAMK2G)
   04024 cAMP signaling pathway
    109372542 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109372542 (CAMK2G)
   04217 Necroptosis
    109372542 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109372542 (CAMK2G)
   04922 Glucagon signaling pathway
    109372542 (CAMK2G)
   04912 GnRH signaling pathway
    109372542 (CAMK2G)
   04921 Oxytocin signaling pathway
    109372542 (CAMK2G)
   04916 Melanogenesis
    109372542 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    109372542 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109372542 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    109372542 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    109372542 (CAMK2G)
   04728 Dopaminergic synapse
    109372542 (CAMK2G)
   04720 Long-term potentiation
    109372542 (CAMK2G)
   04722 Neurotrophin signaling pathway
    109372542 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    109372542 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    109372542 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    109372542 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109372542 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109372542 (CAMK2G)
   05205 Proteoglycans in cancer
    109372542 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    109372542 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109372542 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    109372542 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    109372542 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109372542 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109372542 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109372542 (CAMK2G)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109372542 (CAMK2G)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   109372542 (CAMK2G)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2 RIO1
Other DBs
NCBI-GeneID: 109372542
NCBI-ProteinID: XP_019481434
LinkDB
Position
Un
AA seq 577 aa
MQQFFPPSPSRGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLLKHP
NIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHD
IVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPY
GKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQ
MLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVS
RNFSVGRQSSAPASPAASAASLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSL
VSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEG
RSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFE
PEALGNLVEGMDFHKFYFENLLFKNNKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQ
GRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgcagcagttctttcccccttctccctccaggggtgctttctctgtggtccgcaggtgt
gtgaagaagacctccacgcaggagtatgcagcaaaaatcatcaataccaagaagttgtct
gcccgggatcaccagaaactagaacgggaggcccggatatgccgacttttgaaacatcca
aacattgtgcgcctccatgacagtatttctgaagaagggtttcactacctcgtgtttgac
cttgttaccggcggagagctgtttgaagacatcgtggccagagaatactacagtgaagct
gatgccagccactgtatacatcagattctggagagcgttaaccacatccaccagcatgac
atcgtccacagggacctgaagcctgagaacctgctgctggcgagtaaatgcaagggtgcc
gcagtcaagctggctgattttggcctagccatcgaagtacagggcgagcagcaggcttgg
tttggttttgctggcaccccaggttacttgtcccctgaggtcttgagaaaagatccctat
ggaaaacctgtggatatctgggcctgcggggtcatcctatatatcctcctcgtgggatac
cctcccttctgggatgaggatcaacacaagctgtatcagcagatcaaggccggagcctat
gattttccatcaccagagtgggacacagtgactcctgaagccaaaaacttgatcaaccag
atgctgaccataaaccctgcaaaacgtatcacagctgaccaggctctcaagcatccatgg
gtctgccaacgatccacggtggcatccatgatgcatcgccaggagactgtggagtgcttg
cgcaagttcaacgcccggagaaaactgaagggtgccatcctcacgaccatgcttgtctcc
cggaacttttcagttggcaggcagagctccgcccccgcctcgcctgccgcgagcgccgcc
agcctggccgggcaagctgccaaaagcctactgaacaagaagtcggacggtggtgtcaag
aaaaggaagtcgagttccagcgtgcacctaatgccacagagcaacaacaaaaacagtctc
gtaagcccagcccaagagcccgcgcccttgcagacggccatggagccacaaaccactgtg
gtgcacaacgctacagatgggatcaagggctccacagagagctgcaacaccaccacagaa
gatgaggacctcaaagctgccccgctccgcactgggaatggcagctcggtgcctgaagga
cggagctcccgggacagaacagccccctctgcaggcatgcagccccagccttctctctgc
tcctcagccatgcgaaaacaggaaatcattaagatcacagaacaactgattgaggccatc
aacaatggggactttgaggcctacacgaagatttgcgatccaggcctcacttcctttgag
cctgaggcccttggtaacctcgtggagggaatggatttccataagttttactttgagaat
ctcctcttcaagaacaacaagcccattcacactaccatcctgaaccctcacgtccacgtg
attggagaggacgcagcttgcatcgcctacatccgcctcacccagtacatcgacgggcag
ggccggcctcgcaccagccaatcagaggagacccgggtttggcaccgccgggatggcaag
tggctcaatgtccactatcactgctcaggggcccctgctgcaccgctgcagtga

KEGG   Hipposideros armiger (great roundleaf bat): 109373019
Entry
109373019         CDS       T04661                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04012  ErbB signaling pathway
hai04020  Calcium signaling pathway
hai04024  cAMP signaling pathway
hai04066  HIF-1 signaling pathway
hai04114  Oocyte meiosis
hai04217  Necroptosis
hai04261  Adrenergic signaling in cardiomyocytes
hai04310  Wnt signaling pathway
hai04360  Axon guidance
hai04713  Circadian entrainment
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04728  Dopaminergic synapse
hai04740  Olfactory transduction
hai04750  Inflammatory mediator regulation of TRP channels
hai04911  Insulin secretion
hai04912  GnRH signaling pathway
hai04916  Melanogenesis
hai04921  Oxytocin signaling pathway
hai04922  Glucagon signaling pathway
hai04925  Aldosterone synthesis and secretion
hai04934  Cushing syndrome
hai04971  Gastric acid secretion
hai05012  Parkinson disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05031  Amphetamine addiction
hai05152  Tuberculosis
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05214  Glioma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109373019 (CAMK2B)
   04310 Wnt signaling pathway
    109373019 (CAMK2B)
   04066 HIF-1 signaling pathway
    109373019 (CAMK2B)
   04020 Calcium signaling pathway
    109373019 (CAMK2B)
   04024 cAMP signaling pathway
    109373019 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109373019 (CAMK2B)
   04217 Necroptosis
    109373019 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109373019 (CAMK2B)
   04922 Glucagon signaling pathway
    109373019 (CAMK2B)
   04912 GnRH signaling pathway
    109373019 (CAMK2B)
   04921 Oxytocin signaling pathway
    109373019 (CAMK2B)
   04916 Melanogenesis
    109373019 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    109373019 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109373019 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    109373019 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    109373019 (CAMK2B)
   04728 Dopaminergic synapse
    109373019 (CAMK2B)
   04720 Long-term potentiation
    109373019 (CAMK2B)
   04722 Neurotrophin signaling pathway
    109373019 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    109373019 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    109373019 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    109373019 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109373019 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109373019 (CAMK2B)
   05205 Proteoglycans in cancer
    109373019 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    109373019 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109373019 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    109373019 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    109373019 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109373019 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109373019 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109373019 (CAMK2B)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109373019 (CAMK2B)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   109373019 (CAMK2B)
SSDB
Motif
Pfam: CaMKII_AD Pkinase PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 SnoaL_4 Pkinase_fungal
Other DBs
NCBI-GeneID: 109373019
NCBI-ProteinID: XP_019482119
LinkDB
Position
Un
AA seq 500 aa
MGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKE
AYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLI
NQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTML
ATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAATSPKG
TLPPAALESSDSTHTTIEDEDTKAPKIPDTLSSVRRGSGTPEAEGPPPCPSLAPTSPLPT
PSPRTSDILSSGRRGSGTPEAEGPPLAPSPRISDILNTVRRGSGTPEAQGPPPCPSPVLP
GPPPAPSRKQDIIKITEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFY
FENLLARNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRR
DGKWQNVHFHCSGAPVAPLQ
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgggggtcgtccacagggacctcaagcccgagaacctgctcctggccagcaagtgcaag
ggggctgcagtgaagctggcagacttcggcctggccatcgaggtgcagggggaccagcag
gcgtggttcgggtttgctggcacaccaggctacctatccccagaggtgctgcgcaaggag
gcgtatggcaagccagtggacatctgggcatgcggggtgatcctgtacatcctacttgtg
ggctacccgcccttctgggacgaggaccagcacaaactgtaccagcagatcaaggccggg
gcctacgacttcccatcccccgaatgggacaccgtcacacctgaagccaagaacctcatt
aaccagatgctgaccatcaaccctgccaagcgcatcaccgcacacgaggccctgaagcac
ccgtgggtctgccaacgctccacggtggcttccatgatgcacaggcaggagaccgtggag
tgcctgaaaaagttcaacgcccggaggaagctcaagggcgccatcctcaccactatgctg
gccacgcggaatttctcagtgggcagacagaccaccgctccggccacaatgtccaccgcg
gcctccggcaccaccatggggctggtggaacaagccaagagtctcctcaacaagaaagca
gatggagtcaagccccagacgaatagcaccaagaacagtgcagccaccagccccaagggg
acgcttcctccagccgctctggagtcatccgacagcacccacaccaccatagaggacgag
gacacaaaagcccccaagatccctgacaccctgagctctgtgaggaggggctcgggaacc
ccggaagccgagggccccccgccctgcccatctctggctcccactagtcccctgcccacc
ccatcccccaggacctctgacatcctgagctctgggaggaggggctcggggaccccagaa
gccgagggccccccacttgccccatcccccaggatctctgacatcctgaacacggtgagg
aggggctcggggaccccagaagcccagggccccccaccctgcccgtctccggttctccca
ggccccccacctgccccgtctcgcaagcaggacatcatcaagataacggagcagctcatc
gaggccgtcaacaacggcgacttcgaggcctacgcgaaaatctgcgacccaggcctgacc
tcgttcgagcccgaagctttgggcaacctggtcgaagggatggacttccacaggttctac
tttgagaacctgctcgccagaaacagcaagcccatccacacgaccatcctgaacccacac
gtgcatgtcatcggcgaggacgccgcttgcatcgcctacatccgcctcacgcagtacatc
gacgggcagggccggccccgcaccagccagtccgaggagacccgcgtgtggcaccgccgg
gacggcaagtggcagaacgtgcacttccactgctcgggggcgcccgtggccccgctgcag
tga

KEGG   Hipposideros armiger (great roundleaf bat): 109375001
Entry
109375001         CDS       T04661                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04012  ErbB signaling pathway
hai04020  Calcium signaling pathway
hai04024  cAMP signaling pathway
hai04066  HIF-1 signaling pathway
hai04114  Oocyte meiosis
hai04217  Necroptosis
hai04261  Adrenergic signaling in cardiomyocytes
hai04310  Wnt signaling pathway
hai04360  Axon guidance
hai04713  Circadian entrainment
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04728  Dopaminergic synapse
hai04740  Olfactory transduction
hai04750  Inflammatory mediator regulation of TRP channels
hai04911  Insulin secretion
hai04912  GnRH signaling pathway
hai04916  Melanogenesis
hai04921  Oxytocin signaling pathway
hai04922  Glucagon signaling pathway
hai04925  Aldosterone synthesis and secretion
hai04934  Cushing syndrome
hai04971  Gastric acid secretion
hai05012  Parkinson disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05031  Amphetamine addiction
hai05152  Tuberculosis
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05214  Glioma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109375001 (CAMK2A)
   04310 Wnt signaling pathway
    109375001 (CAMK2A)
   04066 HIF-1 signaling pathway
    109375001 (CAMK2A)
   04020 Calcium signaling pathway
    109375001 (CAMK2A)
   04024 cAMP signaling pathway
    109375001 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109375001 (CAMK2A)
   04217 Necroptosis
    109375001 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109375001 (CAMK2A)
   04922 Glucagon signaling pathway
    109375001 (CAMK2A)
   04912 GnRH signaling pathway
    109375001 (CAMK2A)
   04921 Oxytocin signaling pathway
    109375001 (CAMK2A)
   04916 Melanogenesis
    109375001 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    109375001 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109375001 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    109375001 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    109375001 (CAMK2A)
   04728 Dopaminergic synapse
    109375001 (CAMK2A)
   04720 Long-term potentiation
    109375001 (CAMK2A)
   04722 Neurotrophin signaling pathway
    109375001 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    109375001 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    109375001 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    109375001 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109375001 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109375001 (CAMK2A)
   05205 Proteoglycans in cancer
    109375001 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    109375001 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109375001 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    109375001 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    109375001 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109375001 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109375001 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109375001 (CAMK2A)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109375001 (CAMK2A)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   109375001 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 109375001
NCBI-ProteinID: XP_019485614
LinkDB
Position
Un
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcactcgcttcacagaagagtaccagctcttcgaggaactggga
aagggagccttctcggtggtgcgaaggtgtgtgaaggtgctggctggccaggagtatgct
gccaagatcatcaacaccaagaagctgtcggccagagatcaccagaaactggagcgtgaa
gcccgcatctgccgcctgctgaagcaccccaacattgttcggctccacgacagcatctcc
gaggagggacaccattacctaatctttgacctggtcaccggtggggagctgtttgaagac
atcgtggcccgggagtattacagcgaggccgatgccagtcactgtatccagcagatcctg
gaggccgtgctgcactgccaccagatgggggtggtgcaccgggaccttaagccggagaat
ctgctgctggcctccaagctcaagggcgctgccgtgaagctggcagacttcggcctggcc
atagaggtggagggggagcagcaggcatggtttgggtttgcagggacgcctggatacctc
tccccagaagtgctgcggaaggacccatatgggaaacctgtggacctgtgggcctgtggg
gtcatcctgtacatcctgctagttggctatcccccattttgggatgaggaccagcaccgc
ctgtaccagcagatcaaagctggcgcctatgatttcccatcaccggagtgggacaccgtc
accccggaagccaaggatctcatcaataagatgctgaccatcaacccgtccaaacgcatc
acggctgctgaggcccttaagcacccctggatctcgcaccggtccactgtggcctcttgc
atgcacagacaggagaccgtggactgcctgaagaagttcaacgccaggaggaaactgaag
ggagccatcctcaccacgatgctggccaccaggaatttctctggagggaagagtggagga
aacaagaagaacgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcttcagagagcaccaacaccactatcgaggatgaagacaccaaagtgcggaaacaggaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgtgaccccgggatgacggcctttgaacctgaggctctggggaacctggtc
gagggcctggacttccatcgattctattttgaaaacctgtggtccaggaacagcaaaccc
gtgcacaccaccatcctgaacccccacatccacctgatgggtgacgagtcagcctgcatc
gcctacatccgcatcacacagtacctggacgccggcggcatcccccgcacggcccagtca
gaggagacccgtgtctggcaccgccgcgatggcaaatggcagatcgtccacttccacaga
tctggggcgccctccgtcctgccccattga

KEGG   Hipposideros armiger (great roundleaf bat): 109390284
Entry
109390284         CDS       T04661                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04012  ErbB signaling pathway
hai04020  Calcium signaling pathway
hai04024  cAMP signaling pathway
hai04066  HIF-1 signaling pathway
hai04114  Oocyte meiosis
hai04217  Necroptosis
hai04261  Adrenergic signaling in cardiomyocytes
hai04310  Wnt signaling pathway
hai04360  Axon guidance
hai04713  Circadian entrainment
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04728  Dopaminergic synapse
hai04740  Olfactory transduction
hai04750  Inflammatory mediator regulation of TRP channels
hai04911  Insulin secretion
hai04912  GnRH signaling pathway
hai04916  Melanogenesis
hai04921  Oxytocin signaling pathway
hai04922  Glucagon signaling pathway
hai04925  Aldosterone synthesis and secretion
hai04934  Cushing syndrome
hai04971  Gastric acid secretion
hai05012  Parkinson disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05031  Amphetamine addiction
hai05152  Tuberculosis
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05214  Glioma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109390284 (CAMK2D)
   04310 Wnt signaling pathway
    109390284 (CAMK2D)
   04066 HIF-1 signaling pathway
    109390284 (CAMK2D)
   04020 Calcium signaling pathway
    109390284 (CAMK2D)
   04024 cAMP signaling pathway
    109390284 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109390284 (CAMK2D)
   04217 Necroptosis
    109390284 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109390284 (CAMK2D)
   04922 Glucagon signaling pathway
    109390284 (CAMK2D)
   04912 GnRH signaling pathway
    109390284 (CAMK2D)
   04921 Oxytocin signaling pathway
    109390284 (CAMK2D)
   04916 Melanogenesis
    109390284 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    109390284 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109390284 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    109390284 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    109390284 (CAMK2D)
   04728 Dopaminergic synapse
    109390284 (CAMK2D)
   04720 Long-term potentiation
    109390284 (CAMK2D)
   04722 Neurotrophin signaling pathway
    109390284 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    109390284 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    109390284 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    109390284 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109390284 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109390284 (CAMK2D)
   05205 Proteoglycans in cancer
    109390284 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    109390284 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109390284 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    109390284 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    109390284 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109390284 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109390284 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109390284 (CAMK2D)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109390284 (CAMK2D)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   109390284 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 109390284
NCBI-ProteinID: XP_019512115
LinkDB
Position
Un
AA seq 513 aa
MKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFD
LVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGA
AVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGY
PPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPW
ICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGVKKRK
SSSSVQMTINNKANVVTSPKETAPPPALEPQTTVIHHPDGNKESTESSNTTIEDEDVKAR
KQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKS
NKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVH
FHRSGSPTVPIKPSCIPNGKENFSGSTSLWQNI
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgaaaatccctactggacaggagtatgctgcaaaaatcatcaacaccaagaagctatct
gccagggaccatcagaaactggaaagggaagctagaatctgccgtcttctgaagcacccc
aatattgtgcgacttcatgacagcatatcagaagagggcttccattacttggtgtttgat
ctagtcactggaggggagctgtttgaagacatagtggcgagagaatattacagtgaagct
gacgccagtcattgtatacagcagattctagaaagtgtaaatcattgtcacctaaatggc
atagtgcacagagacctgaagcctgagaatttgcttttagctagcaagtccaagggagca
gccgtgaaactggcagacttcggcctggccattgaagttcaaggggaccagcaggcgtgg
tttggtttcgctggcacgcccggctacctctctccggaagtgctacggaaagacccttac
gggaagccggtggacatgtgggcatgtggtgtcattctctacatccttctggtggggtac
ccgcccttctgggatgaggaccagcacagactctaccagcagatcaaggccggagcctat
gactttccatcaccggagtgggacacagtgactcctgaggccaaagatctcatcaacaag
atgctcaccatcaaccctgccaagcggatcacagcctccgaggccctgaagcacccatgg
atctgccaacggtccacggtggcttccatgatgcacagacaggagacggtcgactgcttg
aagaagttcaacgccaggagaaaactgaagggcgccatcttgacgaccatgcttgccacc
aggaacttctcagcagccaagagtttgctgaagaaaccagatggagtaaagaaaaggaag
tccagttcgagtgttcagatgacgataaacaacaaagccaacgtggtaactagtcccaaa
gagactgcccctcccccggcgctggagccccaaaccactgtaatccaccaccctgacgga
aacaaggagtcgactgagagttccaacacgacaatcgaggacgaagatgtaaaagcacgg
aagcaggagatcatcaaagtcactgagcagctgatcgaagccatcaacaacggggacttc
gaggcgtacacaaaaatctgtgacccaggcctcactgcttttgaacctgaagctttggga
aatttagtggaagggatggactttcatcgattctactttgaaaatgctttgtccaagagc
aacaagccaatccacaccatcatcctgaacccccacgtccatctagtgggggacgatgcc
gcctgcatcgcgtacatccggctcacgcagtacatggatggcagcgggatgccgaaaacc
atgcagtcagaagagacacgcgtgtggcaccgccgggacggcaagtggcagaacgtgcac
tttcatcgctcggggtcgccaaccgtccccatcaagccctcctgtattccaaatgggaag
gaaaacttctcaggaagcacctctttgtggcaaaacatctaa

KEGG   Hipposideros armiger (great roundleaf bat): 109390487
Entry
109390487         CDS       T04661                                 

Gene name
CAMK1D
Definition
(RefSeq) calcium/calmodulin dependent protein kinase ID
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04020  Calcium signaling pathway
hai04921  Oxytocin signaling pathway
hai04925  Aldosterone synthesis and secretion
hai05214  Glioma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109390487 (CAMK1D)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109390487 (CAMK1D)
   04925 Aldosterone synthesis and secretion
    109390487 (CAMK1D)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    109390487 (CAMK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109390487 (CAMK1D)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109390487 (CAMK1D)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   109390487 (CAMK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo RIO1 Pkinase_fungal APH 5_nucleotid Pox_ser-thr_kin Tyrosinase
Other DBs
NCBI-GeneID: 109390487
NCBI-ProteinID: XP_019512534
LinkDB
Position
Un
AA seq 392 aa
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAQERIRLRLPRESSASVGVPQETLLKKPLCLCFRIAGDTALNKNIHESV
SAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLASSTL
CSFISSSSGVSGVGAERRPRPTTVTTVHSGSK
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcccgggagaacggcgagagcagctcctcctggaaaaagcaagcggaggacatcaag
aaaattttcgagttcaaggagacccttggaaccggggcgttttctgaagtggtcttagcc
gaagagaaggcaactggaaagctgtttgcggtgaagtgcatccctaagaaggcgctgaaa
ggcaaggagagcagcatcgagaacgagatagccgttctgagaaagattaagcatgaaaac
attgttgccctggaagacatttatgaaagcccgaatcacctgtacctggtcatgcagctt
gtatctggaggagagctgtttgatcggatagtggagaaaggattttacacagagaaagat
gccagcactctgattcgccaggtcttggatgctgtctactatctccataggatgggcatc
gtccacagggacctcaagcctgaaaatctgttgtactacagtcaagatgaggaatccaaa
ataatgatcagtgactttggattgtccaaaatggagggtaaaggtgatgtgatgtccaca
gcctgtgggacccctggctatgtcgctcctgaggtcctcgcccagaaaccttacagcaaa
gctgttgactgctggtccatcggggtgattgcctatatcttgctctgtggctaccctcct
ttttatgacgaaaatgactccaagctctttgaacagatcctcaaggccgaatatgagttt
gattcgccctactgggatgacatctctgactctgctcaggagaggatcaggctgaggctc
cccagggaaagcagtgccagtgtcggagtcccccaagaaacccttttaaagaagcctctt
tgcctctgtttcaggatcgcaggtgacaccgccctcaacaaaaacatccacgagtccgtc
agcgcccagatccggaagaacttcgccaagagcaaatggagacaagcatttaacgccaca
gccgtcgtgaggcatatgagaaaactccaccttggcagcagtctggacagttcaaatgca
agcgtttccagcagcctcagtctggccagccaaaaagattgtctggcatcctccacgctc
tgtagtttcatttcctcttcgtcaggggtctcaggagtgggagcagagcggagaccgagg
cccaccactgtgacgacagtgcactctggaagcaagtga

KEGG   Hipposideros armiger (great roundleaf bat): 109391534
Entry
109391534         CDS       T04661                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04020  Calcium signaling pathway
hai04024  cAMP signaling pathway
hai04211  Longevity regulating pathway
hai04371  Apelin signaling pathway
hai04380  Osteoclast differentiation
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04921  Oxytocin signaling pathway
hai04925  Aldosterone synthesis and secretion
hai05031  Amphetamine addiction
hai05034  Alcoholism
hai05214  Glioma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109391534 (CAMK4)
   04020 Calcium signaling pathway
    109391534 (CAMK4)
   04024 cAMP signaling pathway
    109391534 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109391534 (CAMK4)
   04925 Aldosterone synthesis and secretion
    109391534 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    109391534 (CAMK4)
   04720 Long-term potentiation
    109391534 (CAMK4)
   04722 Neurotrophin signaling pathway
    109391534 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109391534 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    109391534 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    109391534 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    109391534 (CAMK4)
   05034 Alcoholism
    109391534 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109391534 (CAMK4)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109391534 (CAMK4)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   109391534 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo Pkinase_fungal YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 109391534
NCBI-ProteinID: XP_019514690
LinkDB
Position
Un
AA seq 469 aa
MLKVTVPSCSASSCSSVTASVAPGAGSLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGNIQESQKANREPP
PIQDGNEDVKAVPEGKKVQGDEAQMAVERAEAELMKVQAVQEVKAAAEATKMVPETLADR
IKVADPEKEQGSAEEKLKTVEEAAAPKEGQGNPALGFGAQQNDVILPEY
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcgtgctcggcctcgtcctgctcttcggtcaccgccagt
gtggccccgggggccgggagcctcgtcccggattactggatcgacggctccaacagggat
gctttgagcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtaagaactgagataggagttcttcttcgcctctcacatccaaac
atcataaaacttaaagagatatttgaaacccctacagaaatcagcctggtcctagaactc
gtcacaggaggagagctgtttgataggatcgtggaaaaggggtattacagtgaacgagat
gctgcagatgctgttaaacaaatcctggaggctgttgcttacctacatgaaaatgggatt
gtccaccgtgatctcaaaccagagaatcttctctatgcaactccagcccctgatgcacca
ctcaaaattgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtattgcgcacctgagattcttcgaggttgcgcctatggacca
gaggtagacatgtggtctgtaggaataatcacctacatcttactttgtggatttgaaccg
ttctatgatgaaagaggtgatcagttcatgttcagaagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctaaatgccaaggacttggtcaaaaaatta
attgttttggatcctaagaaacggctgactaccttccaagctctccaacacccatgggtc
acaggtaaagcagccaattttgtgcacatggatactgctcaaaagaagctccaagaattc
aatgcccggcgcaagcttaaggcagcagtaaaggccgtggtggcctcctcccggttggga
agtgccagcagtagccatggcaacatccaggagagccagaaggccaaccgagagccacct
ccaatccaagatggcaatgaagatgttaaagctgtcccagaaggaaagaaagtccaagga
gatgaggcccaaatggcagttgagagggcagaggctgagctgatgaaggtgcaggctgta
caggaagttaaagctgctgctgaggccaccaagatggtgcccgagacactagcggacagg
ataaaggtggctgacccggaaaaggagcagggctcagcagaggagaagctgaagactgtg
gaggaagcagcagcccccaaagaagggcaaggaaaccctgctctggggtttggagctcag
cagaatgatgtgatcctgccagagtactaa

KEGG   Hipposideros armiger (great roundleaf bat): 109396120
Entry
109396120         CDS       T04661                                 

Gene name
CAMK1G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IG
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04020  Calcium signaling pathway
hai04921  Oxytocin signaling pathway
hai04925  Aldosterone synthesis and secretion
hai05214  Glioma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109396120 (CAMK1G)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109396120 (CAMK1G)
   04925 Aldosterone synthesis and secretion
    109396120 (CAMK1G)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    109396120 (CAMK1G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109396120 (CAMK1G)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109396120 (CAMK1G)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   109396120 (CAMK1G)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal RIO1 APH YrbL-PhoP_reg 5_nucleotid
Other DBs
NCBI-GeneID: 109396120
NCBI-ProteinID: XP_019523258
LinkDB
Position
Un
AA seq 498 aa
MGRKEEDDCSSWKKQTTNIRKTFIFMEVLGSDQVNPTIYHRQKRRLFGDPESGGAFSEVF
LVKQRVTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLEDIYESTTHYYLVMQ
LVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENS
KIMITDFGLSKMEQSGVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPP
FYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPSERYTCEKALRHPWIA
GNTALHRDIYPSVSLQIQKNFAKSKWRQAFNAAAVVHHMRKLHMNLHSPGGRPEVENRPP
VTPASEASRPTSPEISITEAPALDQSVALPVLTRLPCQRGPRPTAHSGKSLNCLVNGSLR
ISSSLVPMQQGPLAVGPCGCCASCLSIGNKGKSSYCSEPTLLKKANKKQNFKSEVMVPIK
ASGSSHCRAGQTGVCLIM
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgggtcgaaaggaagaagatgactgcagttcctggaagaaacagaccaccaacatccgg
aaaaccttcatcttcatggaagtgctgggatctgaccaggtcaatcccactatctatcat
cgacagaagagaaggctctttggagacccagagagcggaggagctttctcagaagttttc
ctggtgaagcaaagggtgactgggaagctcttcgccctgaaatgcatcaagaagtcccct
gccttccgggacagcagcctggagaacgagatcgctgtgctgaaaaagatcaagcatgaa
aacatcgtgaccctggaggacatctatgagagcaccacgcactattacctggtcatgcag
cttgtttctggtggggagctctttgaccggatcctggagcgaggtgtctacacagagaag
gatgccagcctggtgatccagcaggttttgtcagctgtgaaatacctccatgagaatggc
atcgtccacagagacttaaagcctgaaaacctgctgtacctcacccctgaagagaattct
aagatcatgatcacagactttggtctgtccaagatggaacagagtggtgtcatgtccact
gcctgtgggaccccaggctacgtggctccggaagtgttggcccagaaaccctacagcaag
gctgtggattgctggtccattggcgtcatcacttacatactgttatgtgggtatcctcct
ttctacgaagaaaccgagtctaagctttttgagaagatcaaggagggctattatgagttt
gagtctccattctgggatgacatttctgagtcagccaaggattttatttgccacttgctg
gagaaggacccgagtgagcggtacacctgtgagaaggccttgaggcacccctggattgct
gggaacacagccctccaccgggacatctacccatcagtcagccttcagatccagaagaac
tttgcaaagagcaagtggaggcaagccttcaacgcagccgctgtggtacatcacatgagg
aagctgcacatgaacctgcacagtccggggggccgcccggaggtggagaacaggccacct
gtcactccagcctcagaagcttcaagacccacctccccggagatcagcatcaccgaggca
cccgccctggaccagagcgtggcactccctgtcctgacccggctgccctgccagcggggc
ccccggcccactgcccacagtggcaagtccctcaactgcctggtcaacggctccctccgc
atcagcagcagcttggtgcccatgcaacaggggcccttggccgtggggccctgtgggtgc
tgcgccagctgcctgagcatcgggaacaaagggaagtcctcctactgctcggagcccacc
ctcctcaaaaaggccaacaaaaaacagaacttcaaatctgaggtcatggtgcccatcaaa
gccagcggcagctcccactgccgggcggggcagaccggagtctgtctcattatgtga

DBGET integrated database retrieval system