KEGG   Hipposideros armiger (great roundleaf bat): 109372655
Entry
109372655         CDS       T04661                                 

Gene name
MX2
Definition
(RefSeq) MX dynamin like GTPase 2
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05160  Hepatitis C
hai05162  Measles
hai05164  Influenza A
hai05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109372655 (MX2)
   05164 Influenza A
    109372655 (MX2)
   05160 Hepatitis C
    109372655 (MX2)
   05165 Human papillomavirus infection
    109372655 (MX2)
SSDB
Motif
Pfam: Dynamin_M GED Dynamin_N
Other DBs
NCBI-GeneID: 109372655
NCBI-ProteinID: XP_019481583
LinkDB
Position
Un
AA seq 618 aa
MRVHVEGEDQLPDGGPPASRPRPGGEGDIQRRRRRRALPGSPECTARRERLLRSERRGKC
RKRDARTENERMCVRARVGEAGRRLVTQQRKGRHFDDIQDIKAQNIIAGTGIGISHELIT
LEITSAEVPDLTLIDLPGIARVAVGNQPPDIGLQIKALIKKYIQRQETINLVVVPCNVDI
ATTEALSMAHEVDPEGDRTIGILTKPDLVDKGTEKGVLNVVQNLTYRLKKGYMIVKCRGQ
QEIMNKLSLAEATKNEMTFFQTHPYFRALLDEGKATVPRLAERLTHELILHINKSLPLLE
NQIRESHQIATEELRQCGENIPSSDTDKMFFLIEKIKAFNRDIEKLVQGEEIVKEKETRL
YNKLREEFKNWICVLEANTKKVTNLIKETVSKYENQYRGKELVGFVNYKTFEAIVQQYLE
YLVDPALNMLQTTVEIVRQNFADTAKKHFDEFYNLNQITQNKIEDIKVGQMQKAENLIRL
QFRMEQLVYCQDQIYSTVLRKYREQAFNPLQTTLQTPVMMKPSVSNDESSVSSITEIGVH
LNAYFSETSNRLANQIPFIIQYFILQENGDSLAKAMMQVLQEKEHYSWLLQEQSETANKR
QYLKEKIYRLTQARHALY
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgcgagttcacgtggagggggaagatcagctaccggacggtggacctccagcttcaaga
ccccgcccaggtggagagggagatatacaaagacgacggcggcggcgggctctacctggg
tccccagaatgcaccgcgcggagagagcggctcctccggtcggagagaagaggaaagtgt
aggaaaagggacgcgaggacggagaatgaacgtatgtgcgtgcgagcgagggttggtgag
gccgggcggcggctggtgacgcagcagcggaaaggaagacattttgatgacattcaggac
atcaaggcccaaaacatcatcgctgggactgggattggcattagccacgagctcatcact
ctggagatcacctctgctgaggtcccggacctgacgctcattgatctccctggcattgcc
agggtggccgtggggaaccagcccccggatattgggctgcagatcaaggcactcatcaag
aaatacatccagaggcaagagacgatcaacttggtggtggtcccctgcaacgtggacatc
gccaccacagaggcgctgagcatggcccatgaggtggaccccgaaggagacaggaccata
gggatcctgaccaaaccagacctagtggacaaaggcactgaaaaaggtgtcctgaatgtg
gtccagaacctcacctaccgtctcaagaaaggctacatgattgtgaagtgccgcggccag
caggaaatcatgaacaagctgagcttggcagaggcgaccaagaacgaaatgacgttcttt
caaacacatccgtatttcagagccctcctggacgaagggaaggccacagtaccccgtctg
gctgaaagactcacccatgagctcatcctacacatcaacaaatcgctcccgttgttagag
aatcaaatcagggagagccaccagattgcgacggaggagctgcgccagtgtggggagaac
atccccagcagtgataccgataagatgttctttctgattgagaaaattaaagcgtttaat
cgggacattgaaaagttagtacaaggagaagaaatagtaaaggaaaaggagacccgctta
tacaacaaactcagagaggagtttaaaaactggatatgcgtacttgaagccaataccaaa
aaagttacaaatcttattaaagaaacagtctcaaaatatgaaaatcagtatcgcggcaaa
gaactggtggggtttgtcaactacaagacattcgaggccatcgtgcagcagtacctggaa
tatctggtagaccctgcactcaacatgctgcagacgactgttgaaattgtccggcaaaat
ttcgctgacacagccaaaaaacattttgacgaattttacaaccttaatcaaataacccag
aacaagattgaagacataaaagtgggacaaatgcaaaaagcggaaaatctgatccgcctt
cagttcaggatggagcagctggtttactgtcaagaccagatttacagcacggttctgaga
aaataccgagaacaggcctttaaccctctccaaacgactcttcagacccctgtgatgatg
aaaccgtcggtttcaaatgacgagtcttcagtttcctccatcactgaaatcggggtacac
ctgaatgcatacttctcggaaaccagcaaccgtcttgccaaccagatcccattcataatt
cagtattttattctccaagagaatggcgactccttggcgaaagccatgatgcaggttctg
caggagaaggaacactattcctggctgcttcaggagcagagtgagaccgccaacaagagg
caatacctcaaggagaaaatttaccggctcacgcaggcgcggcacgctctctat

KEGG   Hipposideros armiger (great roundleaf bat): 109372656
Entry
109372656         CDS       T04661                                 

Definition
(RefSeq) interferon-induced GTP-binding protein Mx1-like
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05160  Hepatitis C
hai05162  Measles
hai05164  Influenza A
hai05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109372656
   05164 Influenza A
    109372656
   05160 Hepatitis C
    109372656
   05165 Human papillomavirus infection
    109372656
SSDB
Motif
Pfam: Dynamin_N Dynamin_M GED MMR_HSR1 AAA_21 AAA_29 CHDNT ABC_tran
Other DBs
NCBI-GeneID: 109372656
NCBI-ProteinID: XP_019481584
LinkDB
Position
Un
AA seq 490 aa
MEEEVGFSLFPSSLAQNAIAGEGMGISHELISLDISSPHVPDLTLIDLPGITRVPVGNQP
ADIGYQIKTLIRKYIFRQETINLVVVPSNVDIATTEALSMAQEVDPDGDRTIGILTKPDL
VDKGTEDKVVDVVRNLGLENVLSSEYEEKVRPCIDLIDSLRALGVEQDMALPAIAVIGDQ
SSGKSSVLEALSGVALPRGSVRLETTVKLTGRPVLSATLMRMPLFPTKLILTGSNQAFGR
AVFLLAALGRLPLVGYETICRQIWKFENQYRGRELPGFVNYKTFENIIKQQVKILEEPAV
DMLHIVTDIVRLAFSDVSEKNYKEFINLHRTSKSKIEDIKLEQEREAEKFIRLHFKMEQI
IYCQDHVYRSTLKKIREEEAEEDKKNKPSRSSVQHNSPNDSIAEILQHLMAYRQEASNRL
SSHIPLIIQYFILQSYGQQLRNSMLQLLQDKEKYSWLLKERSDTSDKRRFLKERHARLTQ
ARHRLAKFPG
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggaagaggaagttgggttttctctttttccctcttctctagcccagaatgccattgcc
ggggaaggaatggggatcagtcacgagctaattagtctggatatcagctcccctcatgtc
cccgatctgaccctgattgacctccctggcatcaccagagtgcctgtgggcaatcagcca
gctgacattggatatcagatcaaaacgctcatcaggaaatacatctttaggcaggagacg
atcaacttggtggtggtgcccagtaatgtggacatcgccaccacagaggcgctgagcatg
gcccaggaggtggaccccgatggcgacaggaccatagggatcctgacgaagcccgacctg
gtggacaaaggcaccgaggacaaggtggtggacgtggtgcgaaacctcgggcttgagaat
gtcctatccagcgagtatgaggagaaggtgcgcccctgcatcgacctcattgactcgctg
cgggccctgggcgtggagcaggacatggccctgcccgccatcgcggtcatcggggaccag
agctccggcaagagctccgtgctggaggcgctgtcgggcgttgccctccccaggggcagc
gtgagactcgaaaccacagtgaagctaacaggcaggcctgtcttgtctgcgactctgatg
agaatgccccttttccccaccaagctgatcctcactggctcaaatcaagctttcggcagg
gctgtgttccttcttgcggccctagggcgcttgcctctggtaggttatgaaactatctgt
aggcagatctggaaatttgaaaaccagtatcgtggcagagagctgccaggattcgtgaac
tataagacgttcgagaacatcataaaacagcaagtcaaaatcctggaagagcccgctgtg
gacatgctgcacatagtaactgatatagtccggcttgccttctcagatgtgtccgagaaa
aattataaggaatttatcaatctccacagaacctccaagtccaaaattgaagacattaaa
ctggaacaagaaagagaagccgagaagttcatccgacttcacttcaaaatggagcagatt
atctactgccaagaccatgtgtatcggagcacactaaagaagatcagagaggaggaagca
gaagaagataagaagaataaaccaagccgttcatccgttcagcacaattctccgaatgac
tccatagccgaaatcttgcaacatctgatggcctaccgccaggaggccagcaaccgcctg
tccagccacatccctctgatcatccagtacttcatcctccagtcatacggccagcagctg
cggaattccatgctccagctgctgcaggacaaggagaagtacagctggctcctgaaggaa
cgcagtgacaccagtgacaagaggaggttcctgaaagagcggcacgcgcgcctgacacag
gctcggcaccggctcgccaaattccctggttaa

DBGET integrated database retrieval system