KEGG   Hipposideros armiger (great roundleaf bat): 109372657
Entry
109372657         CDS       T04661                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05164  Influenza A
hai05202  Transcriptional misregulation in cancer
hai05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109372657 (TMPRSS2)
  09162 Cancer: specific types
   05215 Prostate cancer
    109372657 (TMPRSS2)
  09172 Infectious disease: viral
   05164 Influenza A
    109372657 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hai01002]
    109372657 (TMPRSS2)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109372657 (TMPRSS2)
Peptidases and inhibitors [BR:hai01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109372657 (TMPRSS2)
SSDB
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 Trypsin_2 SRCR Ldl_recept_a
Other DBs
NCBI-GeneID: 109372657
NCBI-ProteinID: XP_019481585
LinkDB
Position
Un
AA seq 384 aa
MENKCSVSGIECGSSGTCVSASHWCDGVLHCPSGEDENRCVRLYGPNFILQVYSSQRKSW
HPVCQDDWSENYGRAACQDMGYRNSFYSSQGIVDDSGATSFMKLNVSAGNTDLYKKLYHS
DVCSSKTVVSLRCIECGVNTKMSRQSRIVGGTSAALGDWPWQVSLHVQGVHVCGGSIITP
EWIVTAAHCVEEPLNNPRYWTAFAGILRQSFMFYGNGYRVEKVISHPNYDSKSKNNDIAL
MKLQTPLTFNDRVKPVCLPNPGLMLEPTQSCWISGWGATYEKGKTSEVLNAVRVPLIEPW
QCNSKYVYNNLITPAMICAGYLQGTIDSCQGDSGGPLVTLKSSVWWLIGDTSWGSGCAKA
NRPGVYGNVTVFTDWIYRQMRANS
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggaaaacaagtgctcggtatccgggatcgagtgtggctcctcggggacctgcgtcagc
gcctctcactggtgtgacggggtcctgcattgccccagcggggaggacgagaaccgatgt
gttcgcctctacggacccaacttcatccttcaggtgtactcgtcccagaggaagtcctgg
caccccgtgtgccaagacgactggagtgaaaactacgggagggcggcgtgccaggacatg
ggctacaggaatagtttttactccagccaaggaatagtggatgacagtggggccaccagc
tttatgaagctgaacgtaagcgccggcaacaccgatctctataagaaactctaccacagc
gatgtctgttcttcaaaaacagtggtttccttacgctgtatcgaatgtggggtcaacacg
aagatgagccgccagagtcggatcgtgggtgggacgagcgcggccctgggggactggccc
tggcaggtcagcctgcacgtccagggggtccacgtctgcggaggctccatcatcaccccc
gagtggatcgtgacagcggctcactgcgtggaagaacctcttaacaacccacggtattgg
acggccttcgcagggattttgagacaatctttcatgttctatggaaacgggtaccgggtg
gaaaaagtgatttctcatccgaattatgactcgaagagcaagaacaatgacatcgcgctt
atgaagctgcagacccctctcacttttaatgacagagtgaaacccgtgtgtctgcccaac
ccgggcttgatgttggagcccacacagtcctgctggatttccgggtggggtgccacctac
gagaaagggaaaacgtcggaggtgctgaacgccgtcagggttcccctcattgagccctgg
caatgcaacagcaaatacgtctacaataacctgatcacgcccgccatgatctgcgcaggg
tatctgcaggggaccattgattcctgccagggtgacagtggcggtcctctggtcactttg
aagagcagcgtctggtggttgattggggacaccagctgggggtctggctgtgccaaggct
aacagaccaggagtgtacggaaacgtgacagtatttacagactggatctatcgacaaatg
agggcaaacagctaa

KEGG   Hipposideros armiger (great roundleaf bat): 109385279
Entry
109385279         CDS       T04661                                 

Gene name
TMPRSS4
Definition
(RefSeq) transmembrane protease, serine 4
  KO
K09635  transmembrane protease serine 4 [EC:3.4.21.-]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109385279 (TMPRSS4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hai01002]
    109385279 (TMPRSS4)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109385279 (TMPRSS4)
Peptidases and inhibitors [BR:hai01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109385279 (TMPRSS4)
SSDB
Motif
Pfam: Trypsin SRCR_2 Trypsin_2 DUF1986 Ldl_recept_a Hepsin-SRCR SRCR
Other DBs
NCBI-GeneID: 109385279
NCBI-ProteinID: XP_019502928
LinkDB
Position
Un
AA seq 435 aa
MDPDSDQPLNSLDVTPMRKPHTPLETFKKVGIPIIAALLSLATIVIMAVLIKMILDKYYF
LCGQALHFIPRSQVCDGQQDCASGEDEQHCIKSFPDGPPVAVRLSRDRSTLQVLDPLTRN
WASACFDNFTEALAQTACGQMGFDSKPTFKAVKIGPDQDLDVVEITANSQELQVRNPSGP
CLSGTLVSLHCLACGESLKAPRVVGGQKASVDAWPWQVSIQYNKQHICGGSILDPHWILT
AAHCFRKYLDVSNWKVRAGSNKLGSFPSTPVAKILVTELNTTYPKEKDIALVKLQYPLTF
SGTVRPICLPFFDEELTPATPLWVIGWGFTEQGGGKMSDTLLQASVQVIDRTRCNAEDAY
QGEVTKEMLCAGILEGGVDTCQGDSGGPLMYHSDLWQVVGIVSWGHGCGGPSTPGVYTKV
TAYLNWIYNVRKSEP
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggatcctgacagtgatcaacccctgaacagccttgatgtcacccccatgcgcaaaccc
cacactcccctggagaccttcaaaaaagtggggatccccatcatcgcagcactgctaagc
ctggcaaccattgtcatcatggctgtcctcatcaagatgattctggacaaatactacttc
ctctgtgggcaggctctccacttcatccccaggagtcaggtgtgtgatggccaacaggac
tgtgcctcaggagaggatgagcagcactgcatcaagagcttccctgatgggcctccagtg
gcagtccgcctctccagagaccgatccacccttcaggtgctggacccgctcacaagaaac
tgggcctctgcctgttttgacaacttcacagaagctctggcccagacagcctgcgggcag
atgggctttgacagcaaacctaccttcaaagctgtgaagattggccccgaccaagatctg
gatgttgttgaaatcacagcaaatagccaggagcttcaggtgcgaaacccaagtggaccc
tgtctctcaggcaccctggtttccctgcactgccttgcctgtggggagagcctgaaggcc
ccgcgggtggtgggcgggcagaaggcctctgtggatgcttggccttggcaggtcagcatc
cagtacaacaagcaacacatctgtggagggagtatcctggacccccactggatcctcaca
gcagctcactgcttcaggaagtatctagacgtgtccaactggaaagtgagggccggctca
aacaaattgggcagcttcccatccacgcctgtggccaagatccttgtcactgagctcaac
accacgtaccccaaagagaaggacattgccctcgtgaagctgcagtacccactcacattc
tcaggcacagtcaggcccatctgcctgcccttctttgatgaggagctcactccagccacc
ccactatgggtcatcggttggggctttacagagcagggtggagggaaaatgtctgataca
ctgctgcaggcatcagtccaggtcattgacagaactcgatgcaatgcagaggatgcatac
caaggggaagttaccaaggagatgctgtgtgcaggcatcctggagggtggcgtggacacc
tgccagggtgacagcggtgggcccctgatgtatcactctgatctgtggcaagtagtgggc
atcgtgagctggggccatggctgtgggggcccaagtaccccaggagtatacaccaaggtc
acagcctatctcaactggatctacaatgtccggaagtctgagccatga

DBGET integrated database retrieval system