KEGG   Hipposideros armiger (great roundleaf bat): 109372681
Entry
109372681         CDS       T04661                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00562  Inositol phosphate metabolism
hai01100  Metabolic pathways
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04070  Phosphatidylinositol signaling system
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04670  Leukocyte transendothelial migration
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04750  Inflammatory mediator regulation of TRP channels
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04930  Type II diabetes mellitus
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04960  Aldosterone-regulated sodium reabsorption
hai04973  Carbohydrate digestion and absorption
hai05010  Alzheimer disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05100  Bacterial invasion of epithelial cells
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05142  Chagas disease
hai05146  Amoebiasis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109372681 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109372681 (PIK3CA)
   04014 Ras signaling pathway
    109372681 (PIK3CA)
   04015 Rap1 signaling pathway
    109372681 (PIK3CA)
   04370 VEGF signaling pathway
    109372681 (PIK3CA)
   04630 JAK-STAT signaling pathway
    109372681 (PIK3CA)
   04668 TNF signaling pathway
    109372681 (PIK3CA)
   04066 HIF-1 signaling pathway
    109372681 (PIK3CA)
   04068 FoxO signaling pathway
    109372681 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    109372681 (PIK3CA)
   04072 Phospholipase D signaling pathway
    109372681 (PIK3CA)
   04071 Sphingolipid signaling pathway
    109372681 (PIK3CA)
   04024 cAMP signaling pathway
    109372681 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    109372681 (PIK3CA)
   04152 AMPK signaling pathway
    109372681 (PIK3CA)
   04150 mTOR signaling pathway
    109372681 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109372681 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    109372681 (PIK3CA)
   04218 Cellular senescence
    109372681 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109372681 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    109372681 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109372681 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109372681 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    109372681 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    109372681 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    109372681 (PIK3CA)
   04660 T cell receptor signaling pathway
    109372681 (PIK3CA)
   04662 B cell receptor signaling pathway
    109372681 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    109372681 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    109372681 (PIK3CA)
   04670 Leukocyte transendothelial migration
    109372681 (PIK3CA)
   04062 Chemokine signaling pathway
    109372681 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109372681 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    109372681 (PIK3CA)
   04929 GnRH secretion
    109372681 (PIK3CA)
   04915 Estrogen signaling pathway
    109372681 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    109372681 (PIK3CA)
   04917 Prolactin signaling pathway
    109372681 (PIK3CA)
   04926 Relaxin signaling pathway
    109372681 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    109372681 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    109372681 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109372681 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109372681 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    109372681 (PIK3CA)
   04722 Neurotrophin signaling pathway
    109372681 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109372681 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    109372681 (PIK3CA)
   04380 Osteoclast differentiation
    109372681 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    109372681 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    109372681 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109372681 (PIK3CA)
   05206 MicroRNAs in cancer
    109372681 (PIK3CA)
   05205 Proteoglycans in cancer
    109372681 (PIK3CA)
   05203 Viral carcinogenesis
    109372681 (PIK3CA)
   05230 Central carbon metabolism in cancer
    109372681 (PIK3CA)
   05231 Choline metabolism in cancer
    109372681 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109372681 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109372681 (PIK3CA)
   05212 Pancreatic cancer
    109372681 (PIK3CA)
   05225 Hepatocellular carcinoma
    109372681 (PIK3CA)
   05226 Gastric cancer
    109372681 (PIK3CA)
   05214 Glioma
    109372681 (PIK3CA)
   05221 Acute myeloid leukemia
    109372681 (PIK3CA)
   05220 Chronic myeloid leukemia
    109372681 (PIK3CA)
   05218 Melanoma
    109372681 (PIK3CA)
   05211 Renal cell carcinoma
    109372681 (PIK3CA)
   05215 Prostate cancer
    109372681 (PIK3CA)
   05213 Endometrial cancer
    109372681 (PIK3CA)
   05224 Breast cancer
    109372681 (PIK3CA)
   05222 Small cell lung cancer
    109372681 (PIK3CA)
   05223 Non-small cell lung cancer
    109372681 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109372681 (PIK3CA)
   05017 Spinocerebellar ataxia
    109372681 (PIK3CA)
   05020 Prion disease
    109372681 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109372681 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109372681 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    109372681 (PIK3CA)
   04931 Insulin resistance
    109372681 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109372681 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109372681 (PIK3CA)
   05135 Yersinia infection
    109372681 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    109372681 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109372681 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    109372681 (PIK3CA)
   05162 Measles
    109372681 (PIK3CA)
   05164 Influenza A
    109372681 (PIK3CA)
   05161 Hepatitis B
    109372681 (PIK3CA)
   05160 Hepatitis C
    109372681 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    109372681 (PIK3CA)
   05163 Human cytomegalovirus infection
    109372681 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109372681 (PIK3CA)
   05169 Epstein-Barr virus infection
    109372681 (PIK3CA)
   05165 Human papillomavirus infection
    109372681 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109372681 (PIK3CA)
   05142 Chagas disease
    109372681 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109372681 (PIK3CA)
   01524 Platinum drug resistance
    109372681 (PIK3CA)
   01522 Endocrine resistance
    109372681 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109372681 (PIK3CA)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     109372681 (PIK3CA)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109372681 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 109372681
NCBI-ProteinID: XP_019481619
LinkDB
Position
Un
AA seq 1087 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRLPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYCHAGLSNRLARDNELRENDKEQLRSICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRTGRRKVSI
REMVKRAGRPEMLPYGCLSIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSHTLHQWL
KDKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHK
KKKFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINL
FSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHT
IKQHALN
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acgttaataacgataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttactcaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgacctgcggctctttcaaccttttttaaaa
gtaattgagccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggctttgct
atcggcatgccagtgtgtgaatttgatatggttaaagacccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaatcatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctgtcatctgaacaactaaaa
ctttgtgttttagaatatcagggcaagtatattttaaaagtatgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggttgcccaatttgatgctgatggctaaagaaagcctttactcgcaactaccaatggac
tgtttcacaatgccatcttattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctatgttagaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttctaat
cccaggtggaatgaatggctgaattacgacatatacattcctgatcttcctcgtgccgct
cgactttgcctttccatttgttctgtcaaaggccgaaagggtgctaaggaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaattggtctgtg
tcccgagaagcaggatttagttattgccatgcaggactgagtaacagactagctagagac
aacgaattaagggaaaatgataaagaacagctccgatcaatttgtacccgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactactgtgtaact
atccctgaaattctacccaaattgcttctgtccgttaaatggaattctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaaacctgaacaggctatggaa
cttctggactgcaactacccagatcctatggttcgaggttttgctgttcgatgcttggaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatccgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgtcgtgcatgcgggatgtatttgaag
cacctgaatagacaagttgaagcaatggaaaagctcattaacttaactgacattctcaag
caagagaagaaggatgagacacaaaaggtacagatgaaatttttagtagagcaaatgcgg
cgaccagatttcatggatgctctacagggctttctgtctcctctaaatcctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcggattatgtcctctgcaaaaaggccactgtgg
ctgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaacaggtagaagaaaagtttccata
agagaaatggtcaaaagggcaggaagaccagaaatgttaccttatggttgtctgtcaatt
ggtgactgtgtgggacttatagaggtggtgagaagttctcacactattatgcaaattcag
tgcaaaggtggcctgaaaggtgcactgcagttcaatagtcacacactacaccagtggctc
aaagacaagaacaaaggagaaatatacgatgcagccattgatctgtttacacgttcctgt
gctggatattgtgtcgctaccttcattttgggaattggagatcgtcacaatagtaacatc
atggttaaagatgacggacaactgtttcatatagattttggacactttttggatcacaag
aagaaaaaatttggctataaaagagaacgtgtaccatttgttttgacacaagatttctta
atagtgatcagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggtttcag
gagatgtgttacaaagcttatctagctattcggcagcatgccaacctcttcataaatctt
ttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgcatac
attcgaaagaccctagctttagataaaactgagcaagaggctttggaatatttcatgaaa
caaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccacaca
attaagcagcatgctttgaactga

KEGG   Hipposideros armiger (great roundleaf bat): 109373811
Entry
109373811         CDS       T04661                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04070  Phosphatidylinositol signaling system
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04670  Leukocyte transendothelial migration
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04750  Inflammatory mediator regulation of TRP channels
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04930  Type II diabetes mellitus
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04960  Aldosterone-regulated sodium reabsorption
hai04973  Carbohydrate digestion and absorption
hai05010  Alzheimer disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05100  Bacterial invasion of epithelial cells
hai05135  Yersinia infection
hai05142  Chagas disease
hai05146  Amoebiasis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109373811 (PIK3R3)
   04014 Ras signaling pathway
    109373811 (PIK3R3)
   04015 Rap1 signaling pathway
    109373811 (PIK3R3)
   04370 VEGF signaling pathway
    109373811 (PIK3R3)
   04630 JAK-STAT signaling pathway
    109373811 (PIK3R3)
   04668 TNF signaling pathway
    109373811 (PIK3R3)
   04066 HIF-1 signaling pathway
    109373811 (PIK3R3)
   04068 FoxO signaling pathway
    109373811 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    109373811 (PIK3R3)
   04072 Phospholipase D signaling pathway
    109373811 (PIK3R3)
   04071 Sphingolipid signaling pathway
    109373811 (PIK3R3)
   04024 cAMP signaling pathway
    109373811 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    109373811 (PIK3R3)
   04152 AMPK signaling pathway
    109373811 (PIK3R3)
   04150 mTOR signaling pathway
    109373811 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109373811 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    109373811 (PIK3R3)
   04218 Cellular senescence
    109373811 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109373811 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    109373811 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109373811 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109373811 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    109373811 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    109373811 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    109373811 (PIK3R3)
   04660 T cell receptor signaling pathway
    109373811 (PIK3R3)
   04662 B cell receptor signaling pathway
    109373811 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    109373811 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    109373811 (PIK3R3)
   04670 Leukocyte transendothelial migration
    109373811 (PIK3R3)
   04062 Chemokine signaling pathway
    109373811 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109373811 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    109373811 (PIK3R3)
   04929 GnRH secretion
    109373811 (PIK3R3)
   04915 Estrogen signaling pathway
    109373811 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    109373811 (PIK3R3)
   04917 Prolactin signaling pathway
    109373811 (PIK3R3)
   04926 Relaxin signaling pathway
    109373811 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    109373811 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    109373811 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109373811 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109373811 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    109373811 (PIK3R3)
   04722 Neurotrophin signaling pathway
    109373811 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109373811 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    109373811 (PIK3R3)
   04380 Osteoclast differentiation
    109373811 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    109373811 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    109373811 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109373811 (PIK3R3)
   05206 MicroRNAs in cancer
    109373811 (PIK3R3)
   05205 Proteoglycans in cancer
    109373811 (PIK3R3)
   05203 Viral carcinogenesis
    109373811 (PIK3R3)
   05230 Central carbon metabolism in cancer
    109373811 (PIK3R3)
   05231 Choline metabolism in cancer
    109373811 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109373811 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109373811 (PIK3R3)
   05212 Pancreatic cancer
    109373811 (PIK3R3)
   05225 Hepatocellular carcinoma
    109373811 (PIK3R3)
   05226 Gastric cancer
    109373811 (PIK3R3)
   05214 Glioma
    109373811 (PIK3R3)
   05221 Acute myeloid leukemia
    109373811 (PIK3R3)
   05220 Chronic myeloid leukemia
    109373811 (PIK3R3)
   05218 Melanoma
    109373811 (PIK3R3)
   05211 Renal cell carcinoma
    109373811 (PIK3R3)
   05215 Prostate cancer
    109373811 (PIK3R3)
   05213 Endometrial cancer
    109373811 (PIK3R3)
   05224 Breast cancer
    109373811 (PIK3R3)
   05222 Small cell lung cancer
    109373811 (PIK3R3)
   05223 Non-small cell lung cancer
    109373811 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109373811 (PIK3R3)
   05017 Spinocerebellar ataxia
    109373811 (PIK3R3)
   05020 Prion disease
    109373811 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109373811 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109373811 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    109373811 (PIK3R3)
   04931 Insulin resistance
    109373811 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109373811 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109373811 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    109373811 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109373811 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    109373811 (PIK3R3)
   05162 Measles
    109373811 (PIK3R3)
   05164 Influenza A
    109373811 (PIK3R3)
   05161 Hepatitis B
    109373811 (PIK3R3)
   05160 Hepatitis C
    109373811 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    109373811 (PIK3R3)
   05163 Human cytomegalovirus infection
    109373811 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109373811 (PIK3R3)
   05169 Epstein-Barr virus infection
    109373811 (PIK3R3)
   05165 Human papillomavirus infection
    109373811 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109373811 (PIK3R3)
   05142 Chagas disease
    109373811 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109373811 (PIK3R3)
   01524 Platinum drug resistance
    109373811 (PIK3R3)
   01522 Endocrine resistance
    109373811 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109373811 (PIK3R3)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109373811 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Fez1 Laminin_I PI_PP_I
Other DBs
NCBI-GeneID: 109373811
NCBI-ProteinID: XP_019483534
LinkDB
Position
Un
AA seq 380 aa
MPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYH
HESLAQYNPKLDVKLMYPVSKYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEE
YTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQYSKEYIERFRREGNEKEIERIMMNYD
KLKSRLGEIHDSKVRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGV
RQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFL
IRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHN
DSLNVRLAYPVHAQMPSLCR
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgccagatggtaccttcttggttagagatgcctcaacaaaaatgcagggagattatact
ttgactttgcggaagggaggcaataataagttaataaagatctatcatcgagatggtaaa
tatggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactatcac
catgaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtgtcc
aaataccaacaggatcagttggtaaaagaagataacattgatgcagtgggtaagaagctg
caagagtatcactctcagtatcaggaaaagagtaaagagtatgacaggctatatgaagaa
tacactagaacatcccaggaaatacagatgaagcggactgcaattgaagcttttaatgaa
acaattaaaatattcgaagagcagtgtcacacacaagaacaatatagtaaagaatatatc
gagcgatttcgcagagaggggaatgaaaaggaaattgaacgaattatgatgaattatgac
aaattgaaatcacgtctgggtgagattcatgatagcaaagtgcgtctagagcaggatttg
aagaaacaagctttggacaaccgggaaatagataaaaaaatgaatagtatcaaacctgac
ctgatccagctgcgcaagatccgagatcagcaccttgtatggctcaaccacaaaggagtg
agacagaagcgcctgaatgcctggctgggaatcaagaatgaggatgctgacgagacctat
tttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgttgag
gatatcaatcgagtacaagcagaggacttgctttatggaaaacctgatggtgcattctta
attcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgccgatggggaagtg
aagcactgtgtgatctacagcactgctcggggctatggctttgcggagccctacaacctg
tacagctcactgaaggagctggtgctccattaccagcagacatctctcgttcagcacaac
gactccctcaacgtcaggcttgcctacccagtccacgcacagatgccctcgctctgcaga
taa

KEGG   Hipposideros armiger (great roundleaf bat): 109381238
Entry
109381238         CDS       T04661                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00562  Inositol phosphate metabolism
hai01100  Metabolic pathways
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04070  Phosphatidylinositol signaling system
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04670  Leukocyte transendothelial migration
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04750  Inflammatory mediator regulation of TRP channels
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04930  Type II diabetes mellitus
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04960  Aldosterone-regulated sodium reabsorption
hai04973  Carbohydrate digestion and absorption
hai05010  Alzheimer disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05100  Bacterial invasion of epithelial cells
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05142  Chagas disease
hai05146  Amoebiasis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109381238 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109381238 (PIK3CD)
   04014 Ras signaling pathway
    109381238 (PIK3CD)
   04015 Rap1 signaling pathway
    109381238 (PIK3CD)
   04370 VEGF signaling pathway
    109381238 (PIK3CD)
   04630 JAK-STAT signaling pathway
    109381238 (PIK3CD)
   04668 TNF signaling pathway
    109381238 (PIK3CD)
   04066 HIF-1 signaling pathway
    109381238 (PIK3CD)
   04068 FoxO signaling pathway
    109381238 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    109381238 (PIK3CD)
   04072 Phospholipase D signaling pathway
    109381238 (PIK3CD)
   04071 Sphingolipid signaling pathway
    109381238 (PIK3CD)
   04024 cAMP signaling pathway
    109381238 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    109381238 (PIK3CD)
   04152 AMPK signaling pathway
    109381238 (PIK3CD)
   04150 mTOR signaling pathway
    109381238 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109381238 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    109381238 (PIK3CD)
   04218 Cellular senescence
    109381238 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109381238 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    109381238 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109381238 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109381238 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    109381238 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    109381238 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    109381238 (PIK3CD)
   04660 T cell receptor signaling pathway
    109381238 (PIK3CD)
   04662 B cell receptor signaling pathway
    109381238 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    109381238 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    109381238 (PIK3CD)
   04670 Leukocyte transendothelial migration
    109381238 (PIK3CD)
   04062 Chemokine signaling pathway
    109381238 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109381238 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    109381238 (PIK3CD)
   04929 GnRH secretion
    109381238 (PIK3CD)
   04915 Estrogen signaling pathway
    109381238 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    109381238 (PIK3CD)
   04917 Prolactin signaling pathway
    109381238 (PIK3CD)
   04926 Relaxin signaling pathway
    109381238 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    109381238 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    109381238 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109381238 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109381238 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    109381238 (PIK3CD)
   04722 Neurotrophin signaling pathway
    109381238 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109381238 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    109381238 (PIK3CD)
   04380 Osteoclast differentiation
    109381238 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    109381238 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    109381238 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381238 (PIK3CD)
   05206 MicroRNAs in cancer
    109381238 (PIK3CD)
   05205 Proteoglycans in cancer
    109381238 (PIK3CD)
   05203 Viral carcinogenesis
    109381238 (PIK3CD)
   05230 Central carbon metabolism in cancer
    109381238 (PIK3CD)
   05231 Choline metabolism in cancer
    109381238 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109381238 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109381238 (PIK3CD)
   05212 Pancreatic cancer
    109381238 (PIK3CD)
   05225 Hepatocellular carcinoma
    109381238 (PIK3CD)
   05226 Gastric cancer
    109381238 (PIK3CD)
   05214 Glioma
    109381238 (PIK3CD)
   05221 Acute myeloid leukemia
    109381238 (PIK3CD)
   05220 Chronic myeloid leukemia
    109381238 (PIK3CD)
   05218 Melanoma
    109381238 (PIK3CD)
   05211 Renal cell carcinoma
    109381238 (PIK3CD)
   05215 Prostate cancer
    109381238 (PIK3CD)
   05213 Endometrial cancer
    109381238 (PIK3CD)
   05224 Breast cancer
    109381238 (PIK3CD)
   05222 Small cell lung cancer
    109381238 (PIK3CD)
   05223 Non-small cell lung cancer
    109381238 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109381238 (PIK3CD)
   05017 Spinocerebellar ataxia
    109381238 (PIK3CD)
   05020 Prion disease
    109381238 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109381238 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109381238 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    109381238 (PIK3CD)
   04931 Insulin resistance
    109381238 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109381238 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109381238 (PIK3CD)
   05135 Yersinia infection
    109381238 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    109381238 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109381238 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    109381238 (PIK3CD)
   05162 Measles
    109381238 (PIK3CD)
   05164 Influenza A
    109381238 (PIK3CD)
   05161 Hepatitis B
    109381238 (PIK3CD)
   05160 Hepatitis C
    109381238 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    109381238 (PIK3CD)
   05163 Human cytomegalovirus infection
    109381238 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109381238 (PIK3CD)
   05169 Epstein-Barr virus infection
    109381238 (PIK3CD)
   05165 Human papillomavirus infection
    109381238 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109381238 (PIK3CD)
   05142 Chagas disease
    109381238 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109381238 (PIK3CD)
   01524 Platinum drug resistance
    109381238 (PIK3CD)
   01522 Endocrine resistance
    109381238 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109381238 (PIK3CD)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     109381238 (PIK3CD)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109381238 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 109381238
NCBI-ProteinID: XP_019495252
LinkDB
Position
Un
AA seq 616 aa
MPPGVDCPMEFWTKEENQSVLVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLTNSQISLL
IGKGLHEFDSLRDPEVNDFRAKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGP
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPMKKPSSTSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQHLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKAVGRAGW
EAGARPRPVLQPRGHLAWGQPWEVRAASSLKPPLGSHKVSKAMVPNCPVPPPREALDRAI
EEFTLSCAGYCVATYVLGIGDRHSDNIMIRENGQLFHIDFGHFLGNFKTKFGINRERVPF
ILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCS
KDIQYLKVKARAGPHQ
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaggaggagaatcagagcgta
ttggttgacttcctgctgcccacgggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcaccatcaagaaggtattgtggcaccgagcccagtatgagccgcttttccac
atgctcagtgaccctgaagcctatgtgtttacctgcgtcaaccagaccgcggagcagcag
gagctggaggacgagcagcggcggctgtgtgacatccagcccttcctgcccgtcctgcgc
ctggtggcccgggagggcgacagggtgaagaagctcaccaactctcagatcagcctcctc
attggcaaaggcctccatgagtttgactcgctgcgggacccggaagtgaatgactttcga
gctaagatgcgccagttctgcgaggaggcggctgcccgccggcagcagctgggctgggag
gcctggctacaatacagctttcctctgcagctggagccctcggcacggagctgggggcct
ggcaccctgcgggtccccaaccgggccctcctggtcaatgtcaagttcgagggcagtgag
gagagcttcaccttccaggtgtccactaaggacgtgcccctggcactgatggcctgcgcc
ctccggaagaaggccacggtgttccggcagcccctggtggagcagcccgaggactacacc
ctgcaggtgaacgggaagcatgaatacctgtatggcagctaccccctctgccagttccag
tatatctgcagctgcctgcacagcgggctgaccccacacctgaccatggtacattcctcc
tccatcctcgccatgcgggacgaacagagcaaccctgccccccaagtccaaaaaccacgc
accaaaccgccccccattcccatgaagaagccctcctctacatccctgtggtccctggaa
cagcctttctgcatcgagctgatccagggcagcaaagtgaatgccgacgagcggatgaag
ctggtggtacaggccgggctgttccacggcaacgagacattgtgcaagacggtctccagc
tccgaggtgagcgtgtgctcggagcccgtgtggaagcagcacctggagtttgacatcaat
gtgtgcgacctgccacgcatggcccgtctctgctttgcgctgtacgctgtgatcgagaag
gccaagaaggctcgctctaccaagaagaagtccaagaaggcggtgggtcgggctggctgg
gaggctggggccaggccccgtccagtcctgcagccccggggccacttagcctggggacag
ccctgggaggtccgtgcggcctcctcgttgaagcctccgctcgggagccacaaggtttct
aaggccatggttcccaattgccccgtccccccacccagggaggccttggatcgagccatc
gaggagttcaccctttcctgcgctggctactgtgtggccacatatgtgctgggcattggc
gatcggcacagcgacaacatcatgatccgagagaatgggcagctgttccacattgatttt
ggccactttctggggaatttcaagaccaagtttggaatcaaccgggagcgagtcccattc
atcctcacctatgactttgtccatgtgattcaacaggggaagactaataatagtgagaaa
tttgaaaggttccgaggctactgtgaaagagcgtacaccatcctgcgtcgccatggactg
ctgttcctccacctctttgccctgatgcgggcagcaggcctgcctgagctcagctgctcc
aaggacatccagtatctcaaggtaaaggccagggcagggccccaccag

KEGG   Hipposideros armiger (great roundleaf bat): 109382484
Entry
109382484         CDS       T04661                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04070  Phosphatidylinositol signaling system
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04670  Leukocyte transendothelial migration
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04750  Inflammatory mediator regulation of TRP channels
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04930  Type II diabetes mellitus
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04960  Aldosterone-regulated sodium reabsorption
hai04973  Carbohydrate digestion and absorption
hai05010  Alzheimer disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05100  Bacterial invasion of epithelial cells
hai05135  Yersinia infection
hai05142  Chagas disease
hai05146  Amoebiasis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109382484 (PIK3R2)
   04014 Ras signaling pathway
    109382484 (PIK3R2)
   04015 Rap1 signaling pathway
    109382484 (PIK3R2)
   04370 VEGF signaling pathway
    109382484 (PIK3R2)
   04630 JAK-STAT signaling pathway
    109382484 (PIK3R2)
   04668 TNF signaling pathway
    109382484 (PIK3R2)
   04066 HIF-1 signaling pathway
    109382484 (PIK3R2)
   04068 FoxO signaling pathway
    109382484 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    109382484 (PIK3R2)
   04072 Phospholipase D signaling pathway
    109382484 (PIK3R2)
   04071 Sphingolipid signaling pathway
    109382484 (PIK3R2)
   04024 cAMP signaling pathway
    109382484 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    109382484 (PIK3R2)
   04152 AMPK signaling pathway
    109382484 (PIK3R2)
   04150 mTOR signaling pathway
    109382484 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109382484 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    109382484 (PIK3R2)
   04218 Cellular senescence
    109382484 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109382484 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    109382484 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109382484 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109382484 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    109382484 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    109382484 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    109382484 (PIK3R2)
   04660 T cell receptor signaling pathway
    109382484 (PIK3R2)
   04662 B cell receptor signaling pathway
    109382484 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    109382484 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    109382484 (PIK3R2)
   04670 Leukocyte transendothelial migration
    109382484 (PIK3R2)
   04062 Chemokine signaling pathway
    109382484 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109382484 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    109382484 (PIK3R2)
   04929 GnRH secretion
    109382484 (PIK3R2)
   04915 Estrogen signaling pathway
    109382484 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    109382484 (PIK3R2)
   04917 Prolactin signaling pathway
    109382484 (PIK3R2)
   04926 Relaxin signaling pathway
    109382484 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    109382484 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    109382484 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109382484 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109382484 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    109382484 (PIK3R2)
   04722 Neurotrophin signaling pathway
    109382484 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109382484 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    109382484 (PIK3R2)
   04380 Osteoclast differentiation
    109382484 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    109382484 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    109382484 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109382484 (PIK3R2)
   05206 MicroRNAs in cancer
    109382484 (PIK3R2)
   05205 Proteoglycans in cancer
    109382484 (PIK3R2)
   05203 Viral carcinogenesis
    109382484 (PIK3R2)
   05230 Central carbon metabolism in cancer
    109382484 (PIK3R2)
   05231 Choline metabolism in cancer
    109382484 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109382484 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109382484 (PIK3R2)
   05212 Pancreatic cancer
    109382484 (PIK3R2)
   05225 Hepatocellular carcinoma
    109382484 (PIK3R2)
   05226 Gastric cancer
    109382484 (PIK3R2)
   05214 Glioma
    109382484 (PIK3R2)
   05221 Acute myeloid leukemia
    109382484 (PIK3R2)
   05220 Chronic myeloid leukemia
    109382484 (PIK3R2)
   05218 Melanoma
    109382484 (PIK3R2)
   05211 Renal cell carcinoma
    109382484 (PIK3R2)
   05215 Prostate cancer
    109382484 (PIK3R2)
   05213 Endometrial cancer
    109382484 (PIK3R2)
   05224 Breast cancer
    109382484 (PIK3R2)
   05222 Small cell lung cancer
    109382484 (PIK3R2)
   05223 Non-small cell lung cancer
    109382484 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109382484 (PIK3R2)
   05017 Spinocerebellar ataxia
    109382484 (PIK3R2)
   05020 Prion disease
    109382484 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109382484 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109382484 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    109382484 (PIK3R2)
   04931 Insulin resistance
    109382484 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109382484 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109382484 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    109382484 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109382484 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    109382484 (PIK3R2)
   05162 Measles
    109382484 (PIK3R2)
   05164 Influenza A
    109382484 (PIK3R2)
   05161 Hepatitis B
    109382484 (PIK3R2)
   05160 Hepatitis C
    109382484 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    109382484 (PIK3R2)
   05163 Human cytomegalovirus infection
    109382484 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109382484 (PIK3R2)
   05169 Epstein-Barr virus infection
    109382484 (PIK3R2)
   05165 Human papillomavirus infection
    109382484 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109382484 (PIK3R2)
   05142 Chagas disease
    109382484 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109382484 (PIK3R2)
   01524 Platinum drug resistance
    109382484 (PIK3R2)
   01522 Endocrine resistance
    109382484 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109382484 (PIK3R2)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109382484 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Tai4 Laminin_I
Other DBs
NCBI-GeneID: 109382484
NCBI-ProteinID: XP_019497576
LinkDB
Position
Un
AA seq 728 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQVLGVAEGNERCPQNVGWMPGL
NERTRQRGDFPGTYVEFLGPVALVRPGPRPRGSRPLPARPREGPPEPGLTLPDLPDQFSP
PDVAPPLLVKLVEAIERTGLDSESLYRPELPTQRTDWSLSDVEQWDAAALADGIKGFLLA
LPAPLVTPEAAAEARRTLQEAVGPVGPALEPPILPLHRALTLRFLLQHLGRMARRAPAPN
LAVRALGTAFGPLLLLRAPPPSPPPPGGVPDGTEPSPDFPALLVEKLLQELLEEQEVAPP
ALPPKPPKAKPAPTGLANEGSLASLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSK
IQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTR
LLYPVSKYQQDQVVKEDSVEAVGAQLKVYHQQYQEKSREYDQLYEEYTRTSQELQMKRTA
IEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRT
KLEQELRAQALDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNE
TEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVV
VDGDTKHCVIYRTATGLGFAEPYNLYGSLKELVLHYQHTSLVQHNDALTVTLAHPVRAPG
PGPPPAAH
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggctggtgctgagggcttccagtaccgtgcactgtacccattccgccgggagcggcca
gaagacctggagctgctgccaggtgacgtgctggtggtaagccgggcagccctgcaggtg
ctgggtgtggctgagggcaacgagcgctgcccgcagaacgtgggctggatgcctggcctc
aatgaacgcacaaggcagcgtggcgactttccgggcacctacgttgagttcctggggcct
gtggccctggtccggcctggccctcgtccccgtggctctcgcccactgcctgccaggccc
cgagaggggccccccgagccaggcctcacactccccgacctgcctgatcagttctccccg
cccgatgtggctcccccgctcctggtgaagcttgtagaagccattgagcggacagggcta
gacagcgaatccctctacaggcctgagctgcccacccagcgcacagactggtccctgagt
gatgtggagcagtgggatgcggcagccctggcggatggcatcaagggcttcctactggct
cttcccgcgcctctcgtgacgccggaggccgcggccgaggctcgccggaccctgcaggag
gccgtggggcctgtgggaccggcgctggagcccccgatactgcctctgcaccgcgcgctc
acactgcgcttcctgctgcagcacctgggccggatggcccggcgcgccccagccccaaac
ctcgcagtgcgagccctgggcactgccttcgggccgctgctgctgctacgcgctccgccg
ccttcgccgccaccgccagggggcgtacccgacgggactgagccgtcccccgatttccca
gctctgttggtggagaagttgcttcaggagctcctggaggaacaggaggtcgcgccccca
gctctgcctcctaaaccacccaaggcaaagccggctcctacagggctggccaatgagggg
agcctggcctccctgcaggatgctgagtggtactggggtgacatctccagggaggaggtg
aatgagaaactccgggacacacctgatggcaccttccttgttcgagatgcctccagcaag
atccagggggagtacacactgaccctcaggaaaggcggcaacaataagttgatcaaggtc
ttccaccgtgatgggcactatggcttctcagagccactcactttctgctctgtcgtggac
ctcatcacccactaccgccatgagtcactggcccagtataatgccaaactggacacgcgg
ctcctgtaccccgtgtccaagtaccagcaggaccaggtcgtcaaggaggacagtgtggag
gcggtgggtgcccagctcaaagtctaccaccagcaataccaggagaagagccgcgaatat
gaccaactctacgaggagtacacacgtacctctcaggaactgcagatgaagcgcactgca
atcgaggccttcaatgaaaccatcaagatcttcgaagaacagggtcagactcaagagaag
tgcagcaaggaatatctagagcgcttccggcgtgagggcaatgagaaagagatgcagagg
atcctcctgaactcagagcggctcaagtctcgcatcgctgagatccatgagagccgcaca
aagctggagcaggagctgcgggcacaggccttggacaacagggagattgacaagcgcatg
aacagcctgaagccagacctcatgcagctgcgcaagatccgagaccagtacctggtgtgg
ctcacccagaaaggcgcccggcagaagaaaatcaatgagtggttggggatcaaaaatgag
actgaggaccagtatgcactgatggaagatgaggacgacctaccccaccatgaggaacgc
acctggtacgtgggcaagatcaaccgcacacaggctgaggaaatgctgagtggcaagcgg
gatggcaccttcctcatccgtgagagcagccagcggggctgctatgcctgctctgtggtg
gtggacggcgacactaagcactgtgtcatctaccgcacggccaccggcttgggctttgcg
gagccctacaacctgtatgggtccctgaaggagctggtgctgcactaccaacacacctcc
ctggtgcagcacaacgacgcgctcactgtcacgctggcccaccccgttcgtgcccctggc
cctgggcccccgcctgccgcccactga

KEGG   Hipposideros armiger (great roundleaf bat): 109394108
Entry
109394108         CDS       T04661                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00562  Inositol phosphate metabolism
hai01100  Metabolic pathways
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04070  Phosphatidylinositol signaling system
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04670  Leukocyte transendothelial migration
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04750  Inflammatory mediator regulation of TRP channels
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04930  Type II diabetes mellitus
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04960  Aldosterone-regulated sodium reabsorption
hai04973  Carbohydrate digestion and absorption
hai05010  Alzheimer disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05100  Bacterial invasion of epithelial cells
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05142  Chagas disease
hai05146  Amoebiasis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109394108 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109394108 (PIK3CB)
   04014 Ras signaling pathway
    109394108 (PIK3CB)
   04015 Rap1 signaling pathway
    109394108 (PIK3CB)
   04370 VEGF signaling pathway
    109394108 (PIK3CB)
   04630 JAK-STAT signaling pathway
    109394108 (PIK3CB)
   04668 TNF signaling pathway
    109394108 (PIK3CB)
   04066 HIF-1 signaling pathway
    109394108 (PIK3CB)
   04068 FoxO signaling pathway
    109394108 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    109394108 (PIK3CB)
   04072 Phospholipase D signaling pathway
    109394108 (PIK3CB)
   04071 Sphingolipid signaling pathway
    109394108 (PIK3CB)
   04024 cAMP signaling pathway
    109394108 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    109394108 (PIK3CB)
   04152 AMPK signaling pathway
    109394108 (PIK3CB)
   04150 mTOR signaling pathway
    109394108 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109394108 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    109394108 (PIK3CB)
   04218 Cellular senescence
    109394108 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109394108 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    109394108 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109394108 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109394108 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    109394108 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    109394108 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    109394108 (PIK3CB)
   04660 T cell receptor signaling pathway
    109394108 (PIK3CB)
   04662 B cell receptor signaling pathway
    109394108 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    109394108 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    109394108 (PIK3CB)
   04670 Leukocyte transendothelial migration
    109394108 (PIK3CB)
   04062 Chemokine signaling pathway
    109394108 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109394108 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    109394108 (PIK3CB)
   04929 GnRH secretion
    109394108 (PIK3CB)
   04915 Estrogen signaling pathway
    109394108 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    109394108 (PIK3CB)
   04917 Prolactin signaling pathway
    109394108 (PIK3CB)
   04926 Relaxin signaling pathway
    109394108 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    109394108 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    109394108 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109394108 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109394108 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    109394108 (PIK3CB)
   04722 Neurotrophin signaling pathway
    109394108 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109394108 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    109394108 (PIK3CB)
   04380 Osteoclast differentiation
    109394108 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    109394108 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    109394108 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109394108 (PIK3CB)
   05206 MicroRNAs in cancer
    109394108 (PIK3CB)
   05205 Proteoglycans in cancer
    109394108 (PIK3CB)
   05203 Viral carcinogenesis
    109394108 (PIK3CB)
   05230 Central carbon metabolism in cancer
    109394108 (PIK3CB)
   05231 Choline metabolism in cancer
    109394108 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109394108 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109394108 (PIK3CB)
   05212 Pancreatic cancer
    109394108 (PIK3CB)
   05225 Hepatocellular carcinoma
    109394108 (PIK3CB)
   05226 Gastric cancer
    109394108 (PIK3CB)
   05214 Glioma
    109394108 (PIK3CB)
   05221 Acute myeloid leukemia
    109394108 (PIK3CB)
   05220 Chronic myeloid leukemia
    109394108 (PIK3CB)
   05218 Melanoma
    109394108 (PIK3CB)
   05211 Renal cell carcinoma
    109394108 (PIK3CB)
   05215 Prostate cancer
    109394108 (PIK3CB)
   05213 Endometrial cancer
    109394108 (PIK3CB)
   05224 Breast cancer
    109394108 (PIK3CB)
   05222 Small cell lung cancer
    109394108 (PIK3CB)
   05223 Non-small cell lung cancer
    109394108 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109394108 (PIK3CB)
   05017 Spinocerebellar ataxia
    109394108 (PIK3CB)
   05020 Prion disease
    109394108 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109394108 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109394108 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    109394108 (PIK3CB)
   04931 Insulin resistance
    109394108 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109394108 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109394108 (PIK3CB)
   05135 Yersinia infection
    109394108 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    109394108 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109394108 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    109394108 (PIK3CB)
   05162 Measles
    109394108 (PIK3CB)
   05164 Influenza A
    109394108 (PIK3CB)
   05161 Hepatitis B
    109394108 (PIK3CB)
   05160 Hepatitis C
    109394108 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    109394108 (PIK3CB)
   05163 Human cytomegalovirus infection
    109394108 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109394108 (PIK3CB)
   05169 Epstein-Barr virus infection
    109394108 (PIK3CB)
   05165 Human papillomavirus infection
    109394108 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109394108 (PIK3CB)
   05142 Chagas disease
    109394108 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109394108 (PIK3CB)
   01524 Platinum drug resistance
    109394108 (PIK3CB)
   01522 Endocrine resistance
    109394108 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109394108 (PIK3CB)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     109394108 (PIK3CB)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109394108 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 DUF4381 DUF4135
Other DBs
NCBI-GeneID: 109394108
NCBI-ProteinID: XP_019519455
LinkDB
Position
Un
AA seq 1007 aa
MEIKGYDIFKMLWKQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLP
VLKLVTRSCDPGEKLDSKIGVLIGKGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLS
WMDWLKQTYPPEHEPSILENLEDKLYGGKLIVAVHFESCQDVFSFQVSPNMNPIKVNELA
IQKRLTIHGKEDEVSPCDYVLQISGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECY
KIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRTISHVWENNNPFQIVLVKGNKLNTEE
TVKVHVRAGLFHGTELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYTV
LDKVKTKKSTKTINSSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPD
ELEEMLNPMGTVQTNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVS
SRGGKKFLAVLKEILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLED
VAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLK
YEPFLDCALSRFLLERALANRRIGQFLFWHLRSEVHIPAVSIQFGVILEAYCRGSVGHMK
VLSKQVSTCFNIHVQFVTWYLMSCIICFYCHFIISYRFNRLIFPLFDFSVEKCKYMDSKM
KPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLA
TGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEEFTL
SCAGYCVASYVLGIGDRHSDNIMVKKNGQLFHIDFGHILGNFKSKFGIKRERVPFILTYD
FIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQY
LKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3024 nt   +upstreamnt  +downstreamnt
atggaaatcaaaggttatgatatttttaagatgttatggaagcaggttcacaattaccca
atgtttaacctccttatggaaattgactcctatatgtttgcatgtgtgaatcaaactgct
gtatatgaggagctcgaagatgaaacaagaagactctgtgatgtcagaccctttcttcca
gttctcaagttagtgacaagaagttgtgacccaggggaaaaattagactcaaaaattgga
gtccttataggaaaaggtctacatgaatttgatgccttgaaggaccctgaagtgaatgaa
ttccgaataaaaatgcgcaaattcagcgaggaaaagattcagtcgcttgtgggattatct
tggatggactggctaaagcagacatatccaccagagcatgaaccatccatccttgaaaac
ttagaagataagctttatggaggaaagctcatcgtggctgttcattttgaaagttgtcag
gatgtgtttagctttcaagtatctcctaatatgaatcctatcaaagtaaatgaattggca
atccaaaaacgtttgactattcatgggaaagaagatgaagttagcccctgtgactatgtg
ttgcaaatcagtgggagagtagaatatgtgtttggtgatcacccactaatccagtttcag
tatatccggaactgtgtaatgaacaggactttgccccattttattcttgtggaatgttac
aagatcaaaaagatgtatgaacaggaaatgattgctatagaagctgccataaatcgaaat
tcatctaaccttcctcttcctttaccaccaaagaaaacgcgaactatttctcatgtgtgg
gaaaataacaaccctttccaaattgtcttggttaagggaaataaacttaacacagaagaa
actgtaaaagttcatgtcagggctggcctttttcatggtactgaactcctgtgtaaaacc
atcgtaagctcagagatatcagggaaaaatgatcatatttggaatgaaccactggaattt
gatattaatacttgtgacctgccacgaatggctagattatgttttgccgtttacacagtt
ttggataaagtgaaaacgaagaaatcaactaaaacaattaattcctctaaatatcagacc
atcaggaaatctgggaaagtgcattaccctgtagcgtgggtaaatacgatggtttttgac
tttaaaggacagttgagatctggagatataatattgcacagctggtcttcatttcctgat
gaacttgaagaaatgttgaatccaatgggaactgttcaaacaaatccatatactgaaaat
gcaacagctttgcatatcaaattcccagagaataaaaaacaaccttattattaccctccc
tttgataagattatcgaaaaggcagctgagattgcaagcagtgatagtgctaatgtatca
agtcggggtggaaaaaaatttcttgctgtactgaaggaaatcttggacagggatcccttg
tctcaactatgtgagaatgaaatggatcttatttggactttgcgacaagactgcagagag
aatttcccacagtcactgccaaaattattactgtcgattaagtggaataaacttgaggat
gttgctcagcttcaggcactacttcagatttggcctaaactgcctccccgggaggccctg
gagcttctagatttcaactatccagatcagtatgtgcgggaatatgctgtgggctgcctg
cgacagatgagtgatgaagaactctctcaatatcttttacaactggtgcaagttttaaaa
tatgagccttttcttgattgtgccctctctagattcctattagaaagagcacttgctaat
cggaggatagggcaatttctattttggcaccttaggtcagaagtgcacattcccgctgtt
tccatacaatttggtgtcatccttgaagcgtattgccggggaagcgtagggcatatgaaa
gtgctttctaagcaggtatcaacttgttttaatattcatgttcaatttgtcacatggtat
ttgatgagctgtatcatatgcttttactgtcatttcattatttcatataggtttaatcgg
ctaattttccccttgtttgatttcagtgttgaaaagtgtaagtacatggattctaaaatg
aagcctttgtggctggtgtacaacaacaaggtgttcggtgaggattcagttggagtgatt
tttaaaaatggtgacgatttacggcaggatatgttgacactccaaatgctgcgcttgatg
gatttactgtggaaagaagctggtctggatcttcggatgttgccttatggctgcttagca
acaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaattgctgacatt
cagctgaacagtagcaatgtggctgctgcagcagccttcaataaagatgcccttctgaac
tggcttaaagaatacaattctggggatgacctggaccgagccattgaggagtttaccctg
tcctgtgctggctactgtgtagcttcttatgtccttgggattggtgacagacatagtgac
aacatcatggtaaagaaaaacggccagctcttccacattgattttggacacattcttgga
aatttcaagtctaaatttggcattaaaagggagcgagtgcctttcattcttacctatgat
ttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaagtttggccggttccgg
cagtgttgtgaggacgcgtatctgattttacgacggcatgggaatctcttcatcactctc
tttgcactgatgttgaccgcagggcttcctgagcttacatcagtcaaagatatacagtat
cttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaatttaagcaa
aaatttgatgaggcactcagggaaagctggactactaaagtgaactggatggcccacaca
gttcggaaagactacagatcttaa

KEGG   Hipposideros armiger (great roundleaf bat): 109395865
Entry
109395865         CDS       T04661                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04070  Phosphatidylinositol signaling system
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04670  Leukocyte transendothelial migration
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04750  Inflammatory mediator regulation of TRP channels
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04930  Type II diabetes mellitus
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04960  Aldosterone-regulated sodium reabsorption
hai04973  Carbohydrate digestion and absorption
hai05010  Alzheimer disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05100  Bacterial invasion of epithelial cells
hai05135  Yersinia infection
hai05142  Chagas disease
hai05146  Amoebiasis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109395865 (PIK3R1)
   04014 Ras signaling pathway
    109395865 (PIK3R1)
   04015 Rap1 signaling pathway
    109395865 (PIK3R1)
   04370 VEGF signaling pathway
    109395865 (PIK3R1)
   04630 JAK-STAT signaling pathway
    109395865 (PIK3R1)
   04668 TNF signaling pathway
    109395865 (PIK3R1)
   04066 HIF-1 signaling pathway
    109395865 (PIK3R1)
   04068 FoxO signaling pathway
    109395865 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    109395865 (PIK3R1)
   04072 Phospholipase D signaling pathway
    109395865 (PIK3R1)
   04071 Sphingolipid signaling pathway
    109395865 (PIK3R1)
   04024 cAMP signaling pathway
    109395865 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    109395865 (PIK3R1)
   04152 AMPK signaling pathway
    109395865 (PIK3R1)
   04150 mTOR signaling pathway
    109395865 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109395865 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    109395865 (PIK3R1)
   04218 Cellular senescence
    109395865 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109395865 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    109395865 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109395865 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109395865 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    109395865 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    109395865 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    109395865 (PIK3R1)
   04660 T cell receptor signaling pathway
    109395865 (PIK3R1)
   04662 B cell receptor signaling pathway
    109395865 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    109395865 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    109395865 (PIK3R1)
   04670 Leukocyte transendothelial migration
    109395865 (PIK3R1)
   04062 Chemokine signaling pathway
    109395865 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109395865 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    109395865 (PIK3R1)
   04929 GnRH secretion
    109395865 (PIK3R1)
   04915 Estrogen signaling pathway
    109395865 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    109395865 (PIK3R1)
   04917 Prolactin signaling pathway
    109395865 (PIK3R1)
   04926 Relaxin signaling pathway
    109395865 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    109395865 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    109395865 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109395865 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109395865 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    109395865 (PIK3R1)
   04722 Neurotrophin signaling pathway
    109395865 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109395865 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    109395865 (PIK3R1)
   04380 Osteoclast differentiation
    109395865 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    109395865 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    109395865 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109395865 (PIK3R1)
   05206 MicroRNAs in cancer
    109395865 (PIK3R1)
   05205 Proteoglycans in cancer
    109395865 (PIK3R1)
   05203 Viral carcinogenesis
    109395865 (PIK3R1)
   05230 Central carbon metabolism in cancer
    109395865 (PIK3R1)
   05231 Choline metabolism in cancer
    109395865 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109395865 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109395865 (PIK3R1)
   05212 Pancreatic cancer
    109395865 (PIK3R1)
   05225 Hepatocellular carcinoma
    109395865 (PIK3R1)
   05226 Gastric cancer
    109395865 (PIK3R1)
   05214 Glioma
    109395865 (PIK3R1)
   05221 Acute myeloid leukemia
    109395865 (PIK3R1)
   05220 Chronic myeloid leukemia
    109395865 (PIK3R1)
   05218 Melanoma
    109395865 (PIK3R1)
   05211 Renal cell carcinoma
    109395865 (PIK3R1)
   05215 Prostate cancer
    109395865 (PIK3R1)
   05213 Endometrial cancer
    109395865 (PIK3R1)
   05224 Breast cancer
    109395865 (PIK3R1)
   05222 Small cell lung cancer
    109395865 (PIK3R1)
   05223 Non-small cell lung cancer
    109395865 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109395865 (PIK3R1)
   05017 Spinocerebellar ataxia
    109395865 (PIK3R1)
   05020 Prion disease
    109395865 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109395865 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109395865 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    109395865 (PIK3R1)
   04931 Insulin resistance
    109395865 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109395865 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109395865 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    109395865 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109395865 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    109395865 (PIK3R1)
   05162 Measles
    109395865 (PIK3R1)
   05164 Influenza A
    109395865 (PIK3R1)
   05161 Hepatitis B
    109395865 (PIK3R1)
   05160 Hepatitis C
    109395865 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    109395865 (PIK3R1)
   05163 Human cytomegalovirus infection
    109395865 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109395865 (PIK3R1)
   05169 Epstein-Barr virus infection
    109395865 (PIK3R1)
   05165 Human papillomavirus infection
    109395865 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109395865 (PIK3R1)
   05142 Chagas disease
    109395865 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109395865 (PIK3R1)
   01524 Platinum drug resistance
    109395865 (PIK3R1)
   01522 Endocrine resistance
    109395865 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109395865 (PIK3R1)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109395865 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 DUF4201 SH3_2 Laminin_I Lant_dehydr_C PI_PP_I FANCI_S2 Mod_r
Other DBs
NCBI-GeneID: 109395865
NCBI-ProteinID: XP_019522792
LinkDB
Position
Un
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEAESEQQALTLQDLAE
QFAPPDIAPPLLIKLLEAIEKKGLECSTLYRTQSSSSPAELRQLLDCEATSMDLETIDVQ
VLADAVKRYLLDLPNPVIPVAVYNEMISLAQEVQSSEEYIQLLKKLIRSPNIPHQYWLTL
EYLLKHFFKLSQTSSKNLLTARVLSELFSPLLFRFPAAGSENTEHLIQIIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgccgaggggtaccagtaccgagcactctatgattataaaaaggaacgagaagaa
gatattgacttgcacttgggtgacatattgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaagcctgaagaaattggctggttaaatggctataat
gaaaccacaggggagagaggggactttccaggaacttacgtagaatatattggaaggaaa
aaaatctcgcctcccaccccaaagccccggccacctcgaccccttcctgttgcaccaggt
tcttcaaaaactgaagcagaaagtgagcaacaagctttgacccttcaggatcttgcagag
cagtttgcccctcctgacattgctccacctctccttatcaagctgctggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcagcccagcagaa
ttacgacagcttcttgattgtgaggccacctccatggacttggaaacaattgatgttcaa
gttttagcagacgctgtcaaacggtatctcctggacttaccaaatcctgtcattccagta
gctgtttacaatgagatgatttccttagcccaagaagtacaaagctccgaagaatatatc
cagctgttgaagaaactcattaggtcacctaacatacctcatcagtattggcttacgcta
gagtatttgctaaaacatttcttcaagctctcccaaacctccagcaaaaatcttctgact
gcaagagtactctctgaacttttcagccctctgcttttcagattcccagcagccggctct
gagaatactgaacacctcatacaaattatagaaattttaatctcaacagaatggaatgaa
cgacagcctgctccagcactgcctcctaaaccaccaaaacccactactgtagccaataac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcgagg
gaagaagtgaatgaaaagcttcgagacacagctgatggaacctttttggtacgagatgca
tctactaaaatgcatggtgattatactcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaactct
gtggttgaattaataaaccactaccggaatgaatctctagctcaatacaatcccaagctg
gatgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtaggaaaaaaattacatgaatataacactcaatttcaagaaaaaagt
cgggaatatgatagattatatgaggattatacccgtacttcccaggagatccaaatgaaa
agaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaaacc
caggagcggtacagcaaagagtacatagaaaagtttaaacgtgaaggcaatgagaaagaa
atacaaaggattatgcataattatgaaaagttaaagtctcgaatcagtgaaattgttgac
agtagaagaagactggaggaagacttaaagaagcaggcagctgagtatcgggagattgac
aaacgcatgaacagcattaaaccagacctcattcaactgagaaagacaagagaccaatac
ttgatgtggttgactcagaaaggcgttcggcaaaagaagttgaacgagtggttgggcaat
gaaaacactgaagaccaatactccctggtggaagacgatgaggatttgcctcatcatgat
gagaagacgtggaatgtcggaagcagcaaccgaaacaaagccgaaaacctactgcgaggg
aagcgcgatggcacttttctggtccgggaaagcagtaaacagggctgctacgcctgctcc
gtagtggtggacggcgaggtgaagcattgtgtcataaacaaaacggccactggctacggc
tttgcggagccctataacttgtacagctccctgaaagaactggtgctacattaccaacac
acctccctcgtgcagcacaacgactccctcaacgtcacactagcctacccggtatatgca
cagcagagacgatga

DBGET integrated database retrieval system