KEGG   Hipposideros armiger (great roundleaf bat): 109372755Help
Entry
109372755         CDS       T04661                                 

Gene name
SLC2A3
Definition
(RefSeq) solute carrier family 2 member 3
  KO
K08142  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hai02000]
    109372755 (SLC2A3)
Transporters [BR:hai02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   109372755 (SLC2A3)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    109372755 (SLC2A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 DUF523
Motif
Other DBs
NCBI-GeneID: 109372755
NCBI-ProteinID: XP_019481740
LinkDB All DBs
Position
Un
AA seq 496 aa AA seqDB search
MGTQKVTAPLIFAIIIAAIGSFQFGYNTGVINAPEMIIKEFINYTMEEKLVNPPTDVFLT
TLWSLSVAIFSIGGMIGSFSVGLFVNRFGRRNSMLIVNLLAIAGGCLMGFCKMAQSVEML
ILGRLVIGLFCGLCTGFVPMYIGEIAPTALRGAFGTLNQLGIVIGILVAQIFGLKVILGT
EDLWPVLLGFTILPAILQSAALPFCPESPRFLLINKKEEESAKRILQRLWGTQDVAQDIQ
EMKDESARMAQEKQVTLLELFRVRSYQQPLMISIMLQLSQQLSGINAVFYYSTGIFKDAG
VPEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAACSVLMTVSLLLKDTYK
WMSFICIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLF
PSAASLLGPYVFIVFTGFLVIFLVFTFFKVPETRGRTFEEITRAFEGQVQGASRAEKGPI
VEMNSIQPAKETDTHV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggggacacaaaaggtcactgcacctctgatctttgccatcatcattgctgcaataggc
tctttccagtttggctacaacactggagtcatcaatgcccctgagatgatcataaaggag
tttatcaattacactatggaagagaagttagtaaaccctcccactgatgtgtttctcaca
accctctggtccttgtcggtggccatcttctccattggtggtatgattggatccttttcc
gttggactctttgtcaaccgctttggcaggcgcaattcaatgcttattgtcaatctgttg
gctatcgctggtggctgccttatgggattctgcaaaatggcacagtcagttgagatgctg
atcctgggccggttggttattggcctcttctgcggactctgcacaggttttgtgcccatg
tacattggagagatagcgcctactgccctgcggggggcctttggcactctcaaccagctg
ggcatcgtcatcgggattctggtggcccagatctttggtctgaaagtcatcttgggaact
gaagatctttggcctgtgctgttgggcttcaccatccttccagctatcctacaaagtgca
gcccttccattctgccccgaaagtcctagattcttgctcattaacaaaaaggaagaggag
agtgctaagaggatcctccagcgattgtggggtacccaggatgtggctcaggacatccag
gagatgaaagatgagagtgctaggatggcacaagaaaaacaagtcactctgttggagctc
ttcagagtacgaagctaccaacagcccctcatgatttccatcatgctccagctctctcag
cagctctctggaatcaatgctgtgttctattactcaacaggaatcttcaaagatgcgggt
gttccggagccgatctatgcaaccattggtgcgggtgtggttaataccatcttcactgta
gtttccctgtttctggtggaaagggcaggaaggaggactctacacatgattggccttgga
gggatggctgcttgttctgttttaatgactgtgtctttgttattaaaggatacctataag
tggatgagctttatctgtattggggctatcttggtcttcgtggcgttctttgaaatcggg
ccaggccccattccctggttcattgtggctgaactcttcagccagggtccccgcccagct
gcaatggcggtggctggttgctccaactggacctccaactttttggttggacttctcttc
ccctcagctgcatctttattaggaccctacgtttttattgtcttcaccggcttccttgtg
atcttcttggtcttcaccttcttcaaagtccctgagacccgtggcagaacttttgaggaa
attacacgagcctttgaagggcaggtacagggggccagcagagctgagaaagggcccatc
gtggagatgaacagcatccagcctgctaaggagaccgacacccatgtctaa

DBGET integrated database retrieval system