KEGG   Hipposideros armiger (great roundleaf bat): 109372772Help
Entry
109372772         CDS       T04661                                 

Gene name
BCL3
Definition
(RefSeq) B-cell CLL/lymphoma 3
  KO
K09258  B-cell CLL/lymphoma protein 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04625  C-type lectin receptor signaling pathway
hai04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109372772 (BCL3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109372772 (BCL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109372772 (BCL3)
   03110 Chaperones and folding catalysts [BR:hai03110]
    109372772 (BCL3)
Transcription factors [BR:hai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    109372772 (BCL3)
Chaperones and folding catalysts [BR:hai03110]
 Other chaperones and cochaperones
  Others
   109372772 (BCL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Motif
Other DBs
NCBI-GeneID: 109372772
NCBI-ProteinID: XP_019481764
LinkDB All DBs
Position
Un
AA seq 453 aa AA seqDB search
MPRCPTGAMDDGPVDLRTRPKAARPPGAALPFRKRPLRVPSPEPAAPRGAAGPFVTPDPL
CCGSDSTAVPAHPHGLARPEAVYYQGPLLPLYPTPTMGSPFPLVRLPPPLYPVVCPMEHP
LSADIAMATRADEDGDTPLHIAVVQGNLPAVNRLVSLFQHGGRELDIYNNLRQTPLHLAV
ITTLPSVVRLLVMAGASPMALDRHGQTAAHLACEHRSPACLRSLLDSAAPGTVDLEARNY
DGLTALHVAVNTECHEAVLLLLERGADIDAVDIKSGRSPLIHAVENNKLSMVQLLLQHGA
NVNAQMYSGSSALHSASGRGLLHLVRMLVRSGADSGLKNCHNDTPLMVARSRKVIDILRG
KATRPAPVQPEPSPDRSATTSPESSSRLSSNGLLSASPSSSPSQSPPKDPPGFPMAPPNF
FLPPSSPPAFLPFAGVLRGPGRPVPPSPAPGGS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgccccgatgccccacaggggccatggacgacgggcccgtggacctgcgcacccggccc
aaggccgcccgaccccccggcgccgcgctgccgttccgcaagcgccccctgcgggtgccc
tccccggagcccgccgccccccgcggcgctgcgggcccctttgtcaccccagatcctcta
tgctgtggctccgactcaacggcggttcccgcgcacccccacggcctggcccggccagag
gcggtttactaccagggacctttactgcccctgtaccccaccccaaccatgggctccccc
tttcctctggtgagactgcctccacccctgtaccctgtggtgtgcccgatggaacacccc
ctgtcagccgacatcgccatggccacccgtgctgatgaggacggagatacgccactccac
attgcggtggtgcagggcaatctgccagctgtgaatcggttagtcagcctcttccagcat
ggaggccgggagctggacatctacaacaacctccggcagacaccactacacctggctgtg
atcacgactttgccgtcagtggttcggctcttggtgatggctggtgccagtcccatggca
ctggaccgccatggccagacagcagcccacctggcgtgtgagcaccgcagcccggcctgc
ctgcggtccctgctggacagtgcggcccccggcacagtggacctggaggctcgcaattac
gatgggctcactgccctgcacgtggccgtgaataccgagtgccacgaagcggtactgctg
ttgctggagcggggcgcagacatcgatgcggtggacattaagagcggccgctccccactc
atccacgccgtggaaaacaacaagctgagcatggtgcaactgctgctgcagcatggcgcc
aacgtgaacgctcagatgtactccggcagctcagctctgcactcagcttcaggccgcggg
ctcctgcacctggtgcgcatgctggttcgcagcggcgcggatagcggcctcaagaactgt
cacaacgacacgccactcatggtggcacgcagccgaaaggtcatcgatatcttgaggggg
aaggccacacggcctgctcctgtacaaccagagccctccccggacaggagtgccaccacc
tcccctgaaagcagcagccgcctcagctccaatggtcttctctctgcatcaccgtcctct
tcgccctcccagtctccccccaaggaccctccaggatttcccatggccccccccaatttc
ttccttcctccctcatctccacctgccttcctgccctttgccggggtcctccgaggccct
ggccggccggtgcccccttccccagctccaggaggcagctga

DBGET integrated database retrieval system