KEGG   Hipposideros armiger (great roundleaf bat): 109373010
Entry
109373010         CDS       T04661                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109373010
SSDB
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 109373010
NCBI-ProteinID: XP_019482110
LinkDB
Position
Un
AA seq 136 aa
MHCLASLVLALLALEATLTLVPAATLPGQAAVCPDLSFSSSSSEESCVNACVTDQNCPQG
TKCCTQSPCGRSCMVPLIVRVPKAGHCPQVQALPNPGPCTEISECSGDDQCDSNKKCCFS
LCAMRCLEPTAEDHLQ
NT seq 411 nt   +upstreamnt  +downstreamnt
atgcactgccttgccagcctggtcctggccctgctggccctggaggccaccctcacactg
gtcccagccgccaccttgccagggcaagccgccgtgtgccccgacctcagcttctcctct
tcctcctccgaggagtcctgcgtaaatgcctgtgtcaccgaccagaactgtccccaaggc
accaagtgctgcactcagagcccctgtggccggtcctgcatggtccccctcatcgtccgt
gtcccgaaggctggccactgcccccaggtgcaggccctgccgaaccccgggccctgcacg
gagatcagcgagtgttctggggacgaccagtgtgacagcaacaagaagtgctgcttcagc
ctgtgtgccatgaggtgtctggagcccacagcagaggaccaccttcagtga

DBGET integrated database retrieval system