KEGG   Hipposideros armiger (great roundleaf bat): 109373047
Entry
109373047         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109373047
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109373047
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109373047
   04612 Antigen processing and presentation
    109373047
   04658 Th1 and Th2 cell differentiation
    109373047
   04659 Th17 cell differentiation
    109373047
   04672 Intestinal immune network for IgA production
    109373047
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109373047
   05322 Systemic lupus erythematosus
    109373047
   05323 Rheumatoid arthritis
    109373047
   05320 Autoimmune thyroid disease
    109373047
   05321 Inflammatory bowel disease
    109373047
   05330 Allograft rejection
    109373047
   05332 Graft-versus-host disease
    109373047
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109373047
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109373047
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109373047
   05152 Tuberculosis
    109373047
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109373047
   05164 Influenza A
    109373047
   05168 Herpes simplex virus 1 infection
    109373047
   05169 Epstein-Barr virus infection
    109373047
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109373047
   05140 Leishmaniasis
    109373047
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109373047
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109373047
  Exosomal proteins of epithelial cells
   109373047
  Exosomal proteins of breast milk
   109373047
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 109373047
NCBI-ProteinID: XP_019482164
LinkDB
Position
Un
AA seq 254 aa
MAIIGVPILGFFIIVLLTSLQESWAIKEDHVIIQAEFYMTPDSSGEFMFDFDGDEIFHVD
LEKKQTVWRLEEFGHFAGFEAQGALANIAVDKANLDTMMKLTNNTPNTNVPPEVTVLPNK
PVELGEPNILICFIDKFSPPAINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCQVDHWGLDEPLLKHWEFEARTPLPETTENVVCALGLIVGLVGIIVGTIFVIK
GVRRGSAAEHRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccataattggagtcccaatattgggatttttcatcatagttctactgactagcctt
caggaatcatgggctatcaaagaggatcatgtgatcatccaagctgagttctatatgacc
cctgattcatctggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
ctggaaaaaaagcagacggtctggcggcttgaagaatttggacattttgccggctttgag
gctcagggtgcattggctaacatagctgtggacaaggccaacctggacaccatgatgaag
cttaccaacaacaccccaaacacaaatgtacctccagaggtgactgtgctcccgaacaag
cctgtggagctgggagagcccaacatcctcatctgtttcattgacaagttctccccacca
gcgatcaatgtcacatggctgcgaaatggaaaacctgtcaccacaggagtgtcagagaca
gtcttcctgcccagggaagaccaccttttccgcaagttccactatctccccttcctgccc
tctaccgaggacgtctacgactgccaggtggatcactggggtttggatgagccgctcctc
aagcactgggagtttgaagcacggacccccctcccagagacaacagagaatgtggtgtgt
gccctgggcctgattgtgggtctggtgggcatcattgttgggaccatcttcgtcatcaag
ggggtgcgcagaggcagtgctgctgaacacagagggcctctgtga

KEGG   Hipposideros armiger (great roundleaf bat): 109373106
Entry
109373106         CDS       T04661                                 

Gene name
DRB
Definition
(RefSeq) H-2 class II histocompatibility antigen, E-S beta chain
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109373106 (DRB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109373106 (DRB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109373106 (DRB)
   04612 Antigen processing and presentation
    109373106 (DRB)
   04658 Th1 and Th2 cell differentiation
    109373106 (DRB)
   04659 Th17 cell differentiation
    109373106 (DRB)
   04672 Intestinal immune network for IgA production
    109373106 (DRB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109373106 (DRB)
   05322 Systemic lupus erythematosus
    109373106 (DRB)
   05323 Rheumatoid arthritis
    109373106 (DRB)
   05320 Autoimmune thyroid disease
    109373106 (DRB)
   05321 Inflammatory bowel disease
    109373106 (DRB)
   05330 Allograft rejection
    109373106 (DRB)
   05332 Graft-versus-host disease
    109373106 (DRB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109373106 (DRB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109373106 (DRB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109373106 (DRB)
   05152 Tuberculosis
    109373106 (DRB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109373106 (DRB)
   05164 Influenza A
    109373106 (DRB)
   05168 Herpes simplex virus 1 infection
    109373106 (DRB)
   05169 Epstein-Barr virus infection
    109373106 (DRB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109373106 (DRB)
   05140 Leishmaniasis
    109373106 (DRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109373106 (DRB)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109373106 (DRB)
  Exosomal proteins of epithelial cells
   109373106 (DRB)
  Exosomal proteins of breast milk
   109373106 (DRB)
SSDB
Motif
Pfam: MHC_II_beta C1-set ig Ig_3 C2-set_2 MHC_I Ig_2 DUF202
Other DBs
NCBI-GeneID: 109373106
NCBI-ProteinID: XP_019482261
LinkDB
Position
Un
AA seq 266 aa
MVYLWFPGGSWTATLTVILMVLSPPLAWARDTPPHFLEYLKGECHFTNGTQRVRLVIRDI
YNGQENLRFDSDVGEFVAVTELGRPTAEAWNSQQDFLERMRAQVDTVCRHNYEVFDNFLV
HRQAEPTVTVYPAKTQRLQHHNLLVCSVNGFYPGDIEVRWWRNGQEEEAGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCQVQHPSLTSPITVEWRAQSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHPGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtatctgtggttccccggaggctcctggacagcaactctgacagtgatattgatg
gtgctgagccctcctctggcctgggccagggacaccccaccacatttcctggagtatctt
aagggcgagtgtcatttcaccaacggaacgcagcgggtgcggcttgtgatcagagacatc
tacaacgggcaggagaacttgcgcttcgacagcgacgtgggggagttcgtggcggtgacc
gagctggggcggccgaccgccgaggcctggaacagccagcaggacttcctggagcggatg
cgggcgcaggtggacacggtgtgcagacacaactacgaggtgtttgataacttcctggtg
catcggcaagctgagcctacagtgactgtgtatcctgcaaagacccagcgcctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggcgacattgaagtcaggtgg
tggcggaatggccaggaagaggaggctggggtcgtctccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctat
acctgccaagtgcagcacccaagcctgacgagccctatcacagtggaatggagggcacag
tctgaatctgcacagagcaagatgctgagtggcgtcgggggcttcgtgctgggtctgctc
ttcctcggggcggggctattcatctacttcaggaatcagaaagggcaccctggacttcag
ccaacaggactcctgagctga

KEGG   Hipposideros armiger (great roundleaf bat): 109373108
Entry
109373108         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109373108
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109373108
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109373108
   04612 Antigen processing and presentation
    109373108
   04658 Th1 and Th2 cell differentiation
    109373108
   04659 Th17 cell differentiation
    109373108
   04672 Intestinal immune network for IgA production
    109373108
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109373108
   05322 Systemic lupus erythematosus
    109373108
   05323 Rheumatoid arthritis
    109373108
   05320 Autoimmune thyroid disease
    109373108
   05321 Inflammatory bowel disease
    109373108
   05330 Allograft rejection
    109373108
   05332 Graft-versus-host disease
    109373108
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109373108
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109373108
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109373108
   05152 Tuberculosis
    109373108
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109373108
   05164 Influenza A
    109373108
   05168 Herpes simplex virus 1 infection
    109373108
   05169 Epstein-Barr virus infection
    109373108
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109373108
   05140 Leishmaniasis
    109373108
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109373108
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109373108
  Exosomal proteins of epithelial cells
   109373108
  Exosomal proteins of breast milk
   109373108
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 SKG6
Other DBs
NCBI-GeneID: 109373108
NCBI-ProteinID: XP_019482262
LinkDB
Position
Un
AA seq 255 aa
MILNRALILGALALTTVMSPSGGDNIVADHVAHYGATLYQSYGPSGQYIFEFDGDEEFYV
DLERKETVWRLPMFSEFVSFDPQGGLRNVATGKYTLDILMKRSNYSAATNEVPEVTVFLK
SPVTLGQPNTLICLVDKILPPVINITWLSNGHPVTEGVFETSFLSRDDHSFLKISYLTFL
PSADDIYDCQVEHWGLDQPLLKHWEPEIPTPMSELTETVVCALGLAVGLVGIVVGTVLII
KGLRSGGPSIRQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacagagctctgattctgggggccctcgccctgaccaccgtgatgagcccc
tctggaggtgacaacattgtggctgaccatgttgcccactacggtgcaactttgtaccag
tcttacggtccctccggccagtacatatttgaatttgatggagacgaggagttctacgtg
gacctggagaggaaggagactgtctggcggctgcctatgtttagtgaatttgtaagtttt
gacccacagggtggactgagaaatgtggctacaggaaaatacaccttggacatcttgatg
aaacgctccaactacagtgcagctaccaacgaggttcctgaggtgactgtgttcctcaag
tccccggtgacgctgggccagcccaacaccctcatctgcctcgtggacaaaatcttacct
cctgtgatcaacatcacatggctgagcaatgggcacccagtcacagagggggtttttgag
accagcttcctgtccagggatgatcattccttcttgaagatcagttacctcaccttcctc
ccttctgctgatgacatatacgactgccaggtggagcactggggcctggaccagccgctt
ctgaagcactgggagcctgagattccaacccccatgtcagagctgacggagaccgtggtc
tgcgccctggggctggctgtgggcctcgtgggcatcgtggtgggcactgtcctcattatc
aaaggcctgcgctcaggtggcccgtcgatacgccaagggcccttatga

KEGG   Hipposideros armiger (great roundleaf bat): 109373109
Entry
109373109         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 2 chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109373109
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109373109
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109373109
   04612 Antigen processing and presentation
    109373109
   04658 Th1 and Th2 cell differentiation
    109373109
   04659 Th17 cell differentiation
    109373109
   04672 Intestinal immune network for IgA production
    109373109
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109373109
   05322 Systemic lupus erythematosus
    109373109
   05323 Rheumatoid arthritis
    109373109
   05320 Autoimmune thyroid disease
    109373109
   05321 Inflammatory bowel disease
    109373109
   05330 Allograft rejection
    109373109
   05332 Graft-versus-host disease
    109373109
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109373109
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109373109
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109373109
   05152 Tuberculosis
    109373109
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109373109
   05164 Influenza A
    109373109
   05168 Herpes simplex virus 1 infection
    109373109
   05169 Epstein-Barr virus infection
    109373109
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109373109
   05140 Leishmaniasis
    109373109
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109373109
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109373109
  Exosomal proteins of epithelial cells
   109373109
  Exosomal proteins of breast milk
   109373109
SSDB
Motif
Pfam: C1-set Ig_3 C2-set_2 Marek_A ig Ig_2
Other DBs
NCBI-GeneID: 109373109
NCBI-ProteinID: XP_019482263
LinkDB
Position
Un
AA seq 160 aa
MSSPVCYSPTVEPTVTISPSKTEALNHHNMLVCAVTDFYPGHIKVRWFRNGQEETAGIVS
TPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVG
GFVLGLLFLGLGLVICHRKQKGLRGPLPGTISTLFIGGGR
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtcctctcctgtctgttactcccccacagtggaacctacagtgaccatctccccatcc
aagacagaggctctaaaccaccacaatatgcttgtctgcgcagtgacagatttctatcca
ggccacatcaaagtccggtggttccggaatggccaggaggagacagccggcatcgtgtcc
accccccttatcaggaatggggactggacgttccagatcctggtgatgctggaaatgacc
ccacagcgaggagacgtctacacctgccacgtggagcaccccagcctccagagccccatc
acggtggagtggcgagcacagtctgaatccgcccagagcaagatgctgagtggcgtcggg
ggcttcgtgctggggctgctcttcctcgggctgggccttgtcatctgtcaccggaaacag
aagggtcttcgtgggcccctgccaggtactatttccactctattcattggtggggggagg
tga

KEGG   Hipposideros armiger (great roundleaf bat): 109376891
Entry
109376891         CDS       T04661                                 

Definition
(RefSeq) boLa class II histocompatibility antigen, DQB*0101 beta chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109376891
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109376891
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109376891
   04612 Antigen processing and presentation
    109376891
   04658 Th1 and Th2 cell differentiation
    109376891
   04659 Th17 cell differentiation
    109376891
   04672 Intestinal immune network for IgA production
    109376891
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109376891
   05322 Systemic lupus erythematosus
    109376891
   05323 Rheumatoid arthritis
    109376891
   05320 Autoimmune thyroid disease
    109376891
   05321 Inflammatory bowel disease
    109376891
   05330 Allograft rejection
    109376891
   05332 Graft-versus-host disease
    109376891
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109376891
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109376891
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109376891
   05152 Tuberculosis
    109376891
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109376891
   05164 Influenza A
    109376891
   05168 Herpes simplex virus 1 infection
    109376891
   05169 Epstein-Barr virus infection
    109376891
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109376891
   05140 Leishmaniasis
    109376891
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109376891
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109376891
  Exosomal proteins of epithelial cells
   109376891
  Exosomal proteins of breast milk
   109376891
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 MHC_I Sacchrp_dh_C
Other DBs
NCBI-GeneID: 109376891
NCBI-ProteinID: XP_019488590
LinkDB
Position
Un
AA seq 269 aa
MSGTMALRIPRGLWTAALMVTLVVLSAPVTESRDSPQDFVFQFSPKCYFTNGTQRVRFLE
RYIYNREEYVRFDSDLGKYVAVTELGRLEAEYFNSQQDILEETRAEVDTVCRHNYENEEA
RTTLKRRVEPSVTISPSKTEALNHHNLLVCAVTDFYPGHIKVRWFWNHQEETAGIVSTPL
IRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFV
LGLLFLGLGLVIHHRKQKGLHGPLPGLLR
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtctgggacgatggctctgcgaatccccagaggcctttggacagcagctttgatggtg
acgctggtggtgctgagcgccccagtgactgagagcagagattctccacaggatttcgtg
ttccagtttagccccaagtgctacttcaccaacgggacgcagcgggtgcggtttttggag
agatacatctacaaccgggaggagtacgtgcgcttcgacagcgacctggggaagtacgtg
gcggtgaccgagctggggcggctggaagccgagtacttcaacagccagcaggacatcctg
gaggagacgcgggcggaggtggacacggtgtgcaggcacaactacgagaacgaggaggcc
cgcacgaccctgaagcggcgagtggaaccttcagtgaccatctccccatccaagacagag
gctctaaaccaccacaacctgcttgtctgcgcggtgacagatttctatccaggccacatc
aaagtccggtggttctggaaccaccaggaggagacagctggcatcgtgtccacccccctt
atcaggaatggggactggacgttccagatcctggtgatgctggaaatgaccccccagcga
ggagacgtctacacctgccacgtggagcaccccagcctccagagccccatcacggtggag
tggcgagcacagtctgaatccgcccagagcaagatgctgagtggcgtcgggggcttcgtg
ctggggctgctcttcctcgggctgggccttgtcatccatcaccggaaacagaagggtctt
catggccccctgccagggctcctgcgctga

KEGG   Hipposideros armiger (great roundleaf bat): 109376893
Entry
109376893         CDS       T04661                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype C beta chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109376893
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109376893
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109376893
   04612 Antigen processing and presentation
    109376893
   04658 Th1 and Th2 cell differentiation
    109376893
   04659 Th17 cell differentiation
    109376893
   04672 Intestinal immune network for IgA production
    109376893
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109376893
   05322 Systemic lupus erythematosus
    109376893
   05323 Rheumatoid arthritis
    109376893
   05320 Autoimmune thyroid disease
    109376893
   05321 Inflammatory bowel disease
    109376893
   05330 Allograft rejection
    109376893
   05332 Graft-versus-host disease
    109376893
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109376893
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109376893
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109376893
   05152 Tuberculosis
    109376893
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109376893
   05164 Influenza A
    109376893
   05168 Herpes simplex virus 1 infection
    109376893
   05169 Epstein-Barr virus infection
    109376893
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109376893
   05140 Leishmaniasis
    109376893
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109376893
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109376893
  Exosomal proteins of epithelial cells
   109376893
  Exosomal proteins of breast milk
   109376893
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2
Other DBs
NCBI-GeneID: 109376893
NCBI-ProteinID: XP_019488592
LinkDB
Position
Un
AA seq 274 aa
MFLLHVEMTVTVPRSPGTVAGIVMFICMVLRTPMAHHRDAPKDFVYQFKGMCYFTNGTER
VRLMARQIYNQEETLHFDSDVGKFVAVTELGRLNAQSWNSQKDLLAEYRALVDTLCRHNY
KETAHFTVQRRVAPTVTISPAKTEALNHHNLLVCLVTNFYPRRIKVRWFRNKQEETAGVV
STPLIQNGDWTYQVLVMLEVTPQRGDIYTCHVEHPSLQSPIIVEWQAQSESAQSKMLSGT
GGFVLGLVFLGLGFIIHLWDKKEHPEGPPAGLVQ
NT seq 825 nt   +upstreamnt  +downstreamnt
atgtttctgcttcacgtggagatgactgtgacagtccccaggagccctgggactgtggct
ggaattgtgatgtttatttgcatggtcctgaggactcccatggctcaccatagagatgct
ccaaaggatttcgtgtaccaatttaagggcatgtgctacttcaccaatgggaccgagcgt
gtccggctcatggccagacaaatctacaaccaggaggagactctgcacttcgacagcgac
gtggggaagtttgtggctgtgacagagctggggcggctgaatgctcagagctggaacagc
cagaaggacctcctggcagagtatcgggccctggtggacacactgtgcagacacaattat
aaggagactgctcacttcactgtgcagcggagagtggcgcccacagtgaccatctcccca
gccaagacagaggccctaaaccaccataacctgctggtctgcttggtgacaaatttctat
cctcgtcgaattaaagtcagatggttccggaacaaacaggaggagacagctggagttgtg
tccacgcctcttattcagaatggggactggacctaccaggttcttgtgatgctagaagta
acaccacagcgtggagacatctacacctgccacgtggagcaccccagcctccagagcccc
atcatagtggagtggcaggcacagtctgaatctgcccagagcaagatgctgagtggaact
gggggttttgtgctggggctggtcttccttggcctgggctttatcatccacctttgggat
aagaaagaacatcctgagggcccacccgcagggcttgtgcagtga

KEGG   Hipposideros armiger (great roundleaf bat): 109376897
Entry
109376897         CDS       T04661                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109376897
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109376897
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109376897
   04612 Antigen processing and presentation
    109376897
   04658 Th1 and Th2 cell differentiation
    109376897
   04659 Th17 cell differentiation
    109376897
   04672 Intestinal immune network for IgA production
    109376897
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109376897
   05322 Systemic lupus erythematosus
    109376897
   05323 Rheumatoid arthritis
    109376897
   05320 Autoimmune thyroid disease
    109376897
   05321 Inflammatory bowel disease
    109376897
   05330 Allograft rejection
    109376897
   05332 Graft-versus-host disease
    109376897
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109376897
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109376897
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109376897
   05152 Tuberculosis
    109376897
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109376897
   05164 Influenza A
    109376897
   05168 Herpes simplex virus 1 infection
    109376897
   05169 Epstein-Barr virus infection
    109376897
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109376897
   05140 Leishmaniasis
    109376897
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109376897
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109376897
  Exosomal proteins of epithelial cells
   109376897
  Exosomal proteins of breast milk
   109376897
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 109376897
NCBI-ProteinID: XP_019488595
LinkDB
Position
Un
AA seq 251 aa
MTIIKALILGTIALTTVMSPCGGEDIVADHVGTYGTNVYQTYGALGQFTYEFDGDELFYV
DLEKMETVWRLPEFSNFTTFEARSALRNIVMAKRNLDILIKNSNFTPATNEIPEVAVFPK
SSVMPGIPNTLICLVDNIFPPVINITWLYNGRSVAEGVAETTFYPKSDHSFLKLSYLTFL
PSSEDFYDCRVEHWGLEEPLLKHWEPEIPTPMSELTETVVCVLGLAVGLVGIVVGTILII
RVLRSGGASRH
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaccatcataaaagctctgattctggggaccattgccctgaccaccgtgatgagcccc
tgtggaggtgaagacattgtggctgaccacgtgggcacttatggcacgaatgtgtaccag
acgtacggcgccttgggtcagtttacatacgaatttgatggagatgagctgttctatgtg
gatctggaaaaaatggaaactgtgtggcggctgcctgagtttagcaatttcaccacattt
gaagctcgaagtgccctgagaaacattgttatggcaaaaagaaatttggacatcttgata
aaaaattccaactttacccctgctaccaatgaaatccctgaagtggccgtgtttcccaaa
tcttctgtgatgccgggtattcccaacaccctcatctgcctggtggacaacatcttccct
cctgtgatcaacatcacttggttgtacaatggccgctccgttgcagaaggtgttgctgag
accaccttctaccccaagagtgaccactctttcctcaagctcagttacctcactttcctt
ccctccagcgaggatttctacgactgcagggtggagcactggggcctggaggagccgctc
ctcaagcattgggagcctgagattccaacccccatgtcagagctgacagagaccgtggtc
tgtgtcctgggcctggccgtgggcctcgtgggcatcgtggtgggcaccatcctaatcatc
cgagtcctgcgctcaggtggcgcctccaggcactga

KEGG   Hipposideros armiger (great roundleaf bat): 109376898
Entry
109376898         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109376898
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109376898
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109376898
   04612 Antigen processing and presentation
    109376898
   04658 Th1 and Th2 cell differentiation
    109376898
   04659 Th17 cell differentiation
    109376898
   04672 Intestinal immune network for IgA production
    109376898
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109376898
   05322 Systemic lupus erythematosus
    109376898
   05323 Rheumatoid arthritis
    109376898
   05320 Autoimmune thyroid disease
    109376898
   05321 Inflammatory bowel disease
    109376898
   05330 Allograft rejection
    109376898
   05332 Graft-versus-host disease
    109376898
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109376898
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109376898
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109376898
   05152 Tuberculosis
    109376898
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109376898
   05164 Influenza A
    109376898
   05168 Herpes simplex virus 1 infection
    109376898
   05169 Epstein-Barr virus infection
    109376898
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109376898
   05140 Leishmaniasis
    109376898
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109376898
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109376898
  Exosomal proteins of epithelial cells
   109376898
  Exosomal proteins of breast milk
   109376898
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 Marek_A
Other DBs
NCBI-GeneID: 109376898
NCBI-ProteinID: XP_019488596
LinkDB
Position
Un
AA seq 255 aa
MILNRALILGALALTTVMSPCGGDNIVADYVASYGATLYQSYGPSGQYIHEFDGDEEFYV
DLEKKETVWRLPIFSELRRFDPQGGLRNVATGKYNLDTLMKRSNYSAATNEVPEVTVFLK
SPVMLGQPNTLICLVDNIFPPVINITWLSNGHPVTEGVSETSFLLKDDYSFLRISYLTFL
PSADNIYDCQVEHWGLDQPLLKHWEPEIPTPMSELTETVVCALGLAVGLVGIMVGTVLII
KGLHSGGPSRRPGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacagagctctgattctgggggccctcgccctgaccaccgtgatgagcccc
tgtggaggtgacaacattgtggctgactacgttgcctcctacggtgcaactttgtatcag
tcttatggtccctctggccagtacatccatgaatttgatggcgatgaggagttctatgtg
gacctggagaaaaaggagactgtctggcggctgcctatctttagtgaattgagacgtttt
gacccacaaggtggactgagaaacgtggctacaggaaaatacaacttggacaccttgatg
aaacgctccaactacagtgcagctaccaatgaggttcctgaggtgaccgtgttcctcaag
tcccctgtaatgttgggccagcccaacaccctcatctgcctcgtggacaacatcttccct
cctgtgatcaacatcacatggctgagcaatgggcacccagtcacagagggggtttctgag
accagcttcctgctcaaagatgattattccttcctgaggatcagttacctcaccttcctc
ccttctgctgacaacatatacgactgccaggtggagcactggggcctggaccagccgctt
ctgaagcactgggagcctgagattccaacccccatgtcagagctgacggagaccgtggtc
tgtgccctgggcctggccgtgggcctcgtgggcatcatggtgggcaccgtcctcattatc
aaaggcctgcactcaggtggcccctccagacgcccagggcccttatga

KEGG   Hipposideros armiger (great roundleaf bat): 109377860
Entry
109377860         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109377860
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109377860
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109377860
   04612 Antigen processing and presentation
    109377860
   04658 Th1 and Th2 cell differentiation
    109377860
   04659 Th17 cell differentiation
    109377860
   04672 Intestinal immune network for IgA production
    109377860
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109377860
   05322 Systemic lupus erythematosus
    109377860
   05323 Rheumatoid arthritis
    109377860
   05320 Autoimmune thyroid disease
    109377860
   05321 Inflammatory bowel disease
    109377860
   05330 Allograft rejection
    109377860
   05332 Graft-versus-host disease
    109377860
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109377860
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109377860
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109377860
   05152 Tuberculosis
    109377860
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109377860
   05164 Influenza A
    109377860
   05168 Herpes simplex virus 1 infection
    109377860
   05169 Epstein-Barr virus infection
    109377860
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109377860
   05140 Leishmaniasis
    109377860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109377860
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109377860
  Exosomal proteins of epithelial cells
   109377860
  Exosomal proteins of breast milk
   109377860
SSDB
Motif
Pfam: C1-set Ig_3 C2-set_2 ig Ig_2 Marek_A
Other DBs
NCBI-GeneID: 109377860
NCBI-ProteinID: XP_019489885
LinkDB
Position
Un
AA seq 154 aa
MPSPVCYSPAVEPTVTISPSKTEALNHHNLLVCSVTDFYPGHIKVRWFRNGQEETAGIVS
TPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVG
GFVLGLLFLGLGLVIRHRKQKGEELWGPGDGLLH
NT seq 465 nt   +upstreamnt  +downstreamnt
atgccctctcctgtctgttactcccccgcagtggaacctacagtgaccatctccccatcc
aagacagaggctctaaaccaccacaacctgcttgtctgctcggtgacagacttctatcca
ggccacatcaaagtccggtggttccggaacggccaggaggagacagccggcattgtgtcc
accccccttattaggaatggggactggacgttccagatcctggtgatgctggaaatgacc
ccacagcgaggagacgtctacacctgccacgtggagcaccccagcctccagagccccatc
acggtggagtggcgagcacagtctgaatccgcccagagcaagatgctgagtggcgtcggg
ggcttcgtgctggggctgctcttcctcgggctgggccttgtcatccgtcaccggaaacag
aagggtgaggagctctggggacctggggacgggctcctgcactga

KEGG   Hipposideros armiger (great roundleaf bat): 109377861
Entry
109377861         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109377861
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109377861
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109377861
   04612 Antigen processing and presentation
    109377861
   04658 Th1 and Th2 cell differentiation
    109377861
   04659 Th17 cell differentiation
    109377861
   04672 Intestinal immune network for IgA production
    109377861
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109377861
   05322 Systemic lupus erythematosus
    109377861
   05323 Rheumatoid arthritis
    109377861
   05320 Autoimmune thyroid disease
    109377861
   05321 Inflammatory bowel disease
    109377861
   05330 Allograft rejection
    109377861
   05332 Graft-versus-host disease
    109377861
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109377861
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109377861
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109377861
   05152 Tuberculosis
    109377861
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109377861
   05164 Influenza A
    109377861
   05168 Herpes simplex virus 1 infection
    109377861
   05169 Epstein-Barr virus infection
    109377861
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109377861
   05140 Leishmaniasis
    109377861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109377861
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109377861
  Exosomal proteins of epithelial cells
   109377861
  Exosomal proteins of breast milk
   109377861
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 MHC_I ig
Other DBs
NCBI-GeneID: 109377861
NCBI-ProteinID: XP_019489889
LinkDB
Position
Un
AA seq 269 aa
MSGTMALRIPGGLWTAALMVTLVVLSAPVAEGRDSPQDIVVQFKCQCYFTNGTQRVRYVA
RWFYNREEYVRFDSDLGKFVAVTELGRLDAESWNSQQDILERKRAEVDTVCRHNYRVIET
PTTLKRRVEPSVTISPSKTEALNHHNLLVCAVTDFYPDHIKVRWFRNHQEETAGIVSTPL
IRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFV
LGLLFLGLGLIIHHRKQNGLRGALPGLLR
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtctgggacgatggctctgcggatcccggggggcctttggacagcagctttgatggtg
acgctagtggtgctgagcgccccagtggctgagggcagagattctccacaggatatcgtg
gtccagtttaagtgccagtgctacttcaccaacgggacgcagagggtgcggtacgtggcc
agatggttctacaaccgggaggagtacgtgcgcttcgacagcgacctggggaagttcgtg
gcggtgaccgagctggggcggctggacgccgagtcctggaacagccagcaggacatcctg
gagcggaagcgggcggaggtggacacggtgtgcagacacaactaccgggtgatagagacc
cccacgaccctgaagcggcgagtggaaccttcagtgaccatctccccatccaagacagag
gctctaaaccaccacaacctgcttgtctgcgcggtgacagacttctatccagaccacatc
aaagtccggtggttccggaaccaccaggaggagacagccggcatcgtgtccacccccctt
atcaggaatggggactggacgttccagatcctggtgatgctggaaatgaccccacagcga
ggagacgtctacacctgccacgtggagcaccccagcctccagagccccatcacggtggag
tggcgggcacagtctgaatccgcccagagcaagatgctgagtggcgtcgggggcttcgtg
ctggggctgctcttcctcgggctgggccttatcatccatcaccggaaacagaatggtctt
cgtggagctctgccagggctcctgcggtga

KEGG   Hipposideros armiger (great roundleaf bat): 109377862
Entry
109377862         CDS       T04661                                 

Definition
(RefSeq) H-2 class II histocompatibility antigen, A-F alpha chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109377862
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109377862
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109377862
   04612 Antigen processing and presentation
    109377862
   04658 Th1 and Th2 cell differentiation
    109377862
   04659 Th17 cell differentiation
    109377862
   04672 Intestinal immune network for IgA production
    109377862
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109377862
   05322 Systemic lupus erythematosus
    109377862
   05323 Rheumatoid arthritis
    109377862
   05320 Autoimmune thyroid disease
    109377862
   05321 Inflammatory bowel disease
    109377862
   05330 Allograft rejection
    109377862
   05332 Graft-versus-host disease
    109377862
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109377862
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109377862
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109377862
   05152 Tuberculosis
    109377862
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109377862
   05164 Influenza A
    109377862
   05168 Herpes simplex virus 1 infection
    109377862
   05169 Epstein-Barr virus infection
    109377862
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109377862
   05140 Leishmaniasis
    109377862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109377862
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109377862
  Exosomal proteins of epithelial cells
   109377862
  Exosomal proteins of breast milk
   109377862
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 109377862
NCBI-ProteinID: XP_019489890
LinkDB
Position
Un
AA seq 263 aa
MEFLIFESQFLLSLGLIWFSSLPVFHLSAHGPHSSADHIAFYGAEFYQSYGPSGQYIFEF
DGDEEFYVDLERKETVWRLPVFSEFTSFDPQGGLRNIAIDKHNIDILSKRSNYTAATNEV
PEVTVFPKSPVTLGQPNTLICLVDNIFPPVINITWLSNGHPVTEGVFETSFLSKDDHSFL
KMSYLTFLPSADNIYDCKVEHWGLDQPLLKHWEPEIPTPMSELTETVVCALGLAVGLVGV
VVGTVLIIKGLRSGGASRRPGPL
NT seq 792 nt   +upstreamnt  +downstreamnt
atggagttcctgatatttgagagtcagtttcttctgtcgcttggtttaatatggttctct
tctctccctgttttccacctttctgctcatggccctcactcatcagctgaccacattgcc
ttctacggtgcagaattctaccagtcttatggtccctccggccagtacatctttgaattt
gatggagacgaggagttctacgtggacctggagaggaaggagactgtctggcggctgcct
gtctttagtgaatttacaagttttgacccacagggtggactgagaaacatagctatagac
aaacataacattgacatcttgagtaaacgctccaactacactgcagctaccaatgaggtt
cctgaggtgactgtgttccccaagtccccggtgacgctgggccagcccaacaccctcatc
tgcctggtggacaacatcttccctcctgtgatcaacatcacatggctgagcaatgggcac
ccagtcacagagggggtttttgagaccagcttcctgtccaaggatgatcattccttcttg
aagatgagttacctcaccttcctcccttctgctgacaacatatacgactgcaaggtggag
cactggggcctggaccagccgcttctgaagcactgggagcctgagattccaacccccatg
tcagagctgacggagaccgtggtctgcgccctggggctggccgtgggccttgtgggcgtc
gtggtgggcaccgtcctcattatcaaaggcctgcgctctggtggtgcctccagacgccca
gggcccttatga

KEGG   Hipposideros armiger (great roundleaf bat): 109377863
Entry
109377863         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109377863
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109377863
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109377863
   04612 Antigen processing and presentation
    109377863
   04658 Th1 and Th2 cell differentiation
    109377863
   04659 Th17 cell differentiation
    109377863
   04672 Intestinal immune network for IgA production
    109377863
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109377863
   05322 Systemic lupus erythematosus
    109377863
   05323 Rheumatoid arthritis
    109377863
   05320 Autoimmune thyroid disease
    109377863
   05321 Inflammatory bowel disease
    109377863
   05330 Allograft rejection
    109377863
   05332 Graft-versus-host disease
    109377863
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109377863
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109377863
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109377863
   05152 Tuberculosis
    109377863
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109377863
   05164 Influenza A
    109377863
   05168 Herpes simplex virus 1 infection
    109377863
   05169 Epstein-Barr virus infection
    109377863
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109377863
   05140 Leishmaniasis
    109377863
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109377863
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109377863
  Exosomal proteins of epithelial cells
   109377863
  Exosomal proteins of breast milk
   109377863
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 I-set SKG6
Other DBs
NCBI-GeneID: 109377863
NCBI-ProteinID: XP_019489892
LinkDB
Position
Un
AA seq 255 aa
MILNRALILGALALTTVMSPSGGDNIVADHIAHYGALFYQSYGPSGQYIHEFDGDEEFYV
DLERKETVWQLPIFSEFTSFDPQGGLRNVATGKHNLGFWMKRSNYTAATNEVPEVTVFLK
TPVTLGQPNTLICLVDNIFPPVLNITWLSNGHPVTEGVSETSFLTKDDDSFLKISYLTFL
PSADDVYDCQVEHWGLDEPLLKHWEPEIATPMSELTETVVCALGLAVGLVGIVVGTVFII
QGLRSGGTSRRQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacagagctctgattctgggggccctcgccctgaccactgtgatgagcccc
tctggaggagacaacattgtggctgaccacattgcccactatggtgcacttttctaccag
tcttacggtccctccggccagtacatccatgaatttgatggagacgaggagttctacgtg
gacctggagaggaaggagactgtctggcagctgcctatctttagtgaatttacaagtttt
gacccacagggtggactgagaaacgtggctacaggaaagcacaacttgggcttctggatg
aaacgctccaactacactgcagctaccaatgaggttcctgaggtgaccgtgttcctcaag
accccagtgacgctgggccagcccaacaccctcatctgcctggtggacaacatcttccct
cctgtgctcaacatcacgtggctgagcaatgggcacccagtcacagagggggtttctgag
accagcttcctgaccaaggatgatgattccttcttgaagatcagttacctcaccttcctc
ccttctgctgacgacgtttatgactgccaggtggagcactggggcctggatgagccgctt
ctgaagcactgggagcctgagattgcaacccccatgtcagagctgacggagaccgtggtc
tgcgccctgggcctggctgtgggcctcgtgggcatcgtggtgggcactgtcttcattatc
caaggcctgcgctcaggtggcacctccagacgccaagggcccttatga

KEGG   Hipposideros armiger (great roundleaf bat): 109377864
Entry
109377864         CDS       T04661                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109377864
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109377864
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109377864
   04612 Antigen processing and presentation
    109377864
   04658 Th1 and Th2 cell differentiation
    109377864
   04659 Th17 cell differentiation
    109377864
   04672 Intestinal immune network for IgA production
    109377864
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109377864
   05322 Systemic lupus erythematosus
    109377864
   05323 Rheumatoid arthritis
    109377864
   05320 Autoimmune thyroid disease
    109377864
   05321 Inflammatory bowel disease
    109377864
   05330 Allograft rejection
    109377864
   05332 Graft-versus-host disease
    109377864
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109377864
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109377864
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109377864
   05152 Tuberculosis
    109377864
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109377864
   05164 Influenza A
    109377864
   05168 Herpes simplex virus 1 infection
    109377864
   05169 Epstein-Barr virus infection
    109377864
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109377864
   05140 Leishmaniasis
    109377864
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109377864
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109377864
  Exosomal proteins of epithelial cells
   109377864
  Exosomal proteins of breast milk
   109377864
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 109377864
NCBI-ProteinID: XP_019489893
LinkDB
Position
Un
AA seq 251 aa
MTTIKALILRTLALTTVMSPCGGEDIVADHVGTYGTNVYQMYGALGQFTYEFDGDELFYV
DLEKMETVWRLPEFNNFTIFEARSALRNIVMAKRNLDILIKNSNFTPATNEIPEVAVFPK
SSVMPGIPNTLICLVDNIFPPVINITWLYNGRSVAEGVAETTFYPKSDHSFLKLSYLTFL
PSSEDFYDCRVEHWGLEEPLLKHWEPEIPTPMSELTETVVCVLGLAVGLVGIVVGTILII
RVLRSGGASRH
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaccaccataaaagctctgattctgaggacccttgctctgaccacagtgatgagcccc
tgtggaggtgaagacattgtggccgaccacgtgggcacttatggcacgaatgtgtaccag
atgtatggcgccttgggccagtttacatacgaatttgatggagatgagctgttctacgtg
gatctggaaaaaatggaaactgtgtggcggctgcccgagtttaacaatttcaccatattt
gaagctcgaagtgccctgagaaacattgttatggcaaaaagaaatttggacatcttgata
aaaaattccaactttacgcctgccaccaatgaaatccctgaagtggccgtgtttcccaaa
tcttctgtgatgccgggtattcccaacaccctcatctgcctggtggacaacatcttccct
cctgtgatcaacatcacttggttgtacaatggccgctccgttgcagaaggtgttgctgag
accaccttctaccccaagagtgaccactctttcctcaagctcagttacctcactttcctt
ccctccagcgaggatttctacgactgcagggtggagcactggggcctggaggagccgctc
ctcaagcattgggagcctgagattccaacccccatgtcagagctgacagagaccgtggtc
tgtgtcctgggcctggccgtgggcctcgtgggcatcgtggtgggcaccatcctaatcatc
cgagtcctgcgctcaggtggcgcctccaggcactga

KEGG   Hipposideros armiger (great roundleaf bat): 109378145
Entry
109378145         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain-like
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109378145
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109378145
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109378145
   04612 Antigen processing and presentation
    109378145
   04658 Th1 and Th2 cell differentiation
    109378145
   04659 Th17 cell differentiation
    109378145
   04672 Intestinal immune network for IgA production
    109378145
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109378145
   05322 Systemic lupus erythematosus
    109378145
   05323 Rheumatoid arthritis
    109378145
   05320 Autoimmune thyroid disease
    109378145
   05321 Inflammatory bowel disease
    109378145
   05330 Allograft rejection
    109378145
   05332 Graft-versus-host disease
    109378145
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109378145
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109378145
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109378145
   05152 Tuberculosis
    109378145
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109378145
   05164 Influenza A
    109378145
   05168 Herpes simplex virus 1 infection
    109378145
   05169 Epstein-Barr virus infection
    109378145
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109378145
   05140 Leishmaniasis
    109378145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109378145
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109378145
  Exosomal proteins of epithelial cells
   109378145
  Exosomal proteins of breast milk
   109378145
SSDB
Motif
Pfam: C1-set Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 109378145
NCBI-ProteinID: XP_019490148
LinkDB
Position
Un
AA seq 171 aa
MLCRHNYKLGAPFTVGRKVQPEVTVYPERPPTLQHHSVLLCSVTGFYPGDITIRWFRNGQ
EDRAAIMSTGLIRNGDWTFQKMVMLEMTPELGDVYTCLVEHASLPSPVSVEWRAQSEYSW
RKVLSGVVAFLLGLIFLLVGITVHLRAWKGYVETQLSGDEFSRAVSPPPPH
NT seq 516 nt   +upstreamnt  +downstreamnt
atgctctgcagacacaactacaagctgggtgcacccttcactgtggggagaaaagtgcaa
ccagaggtgacagtatatccggagaggcccccaaccctgcagcaccacagcgtgctgctt
tgctctgtgacaggtttctatccaggggacattacgatcagatggttccggaatgggcag
gaagacagagcggcgatcatgtccactggccttatcaggaatggagactggacctttcag
aaaatggtgatgctggaaatgactcctgagcttggagacgtctacacctgccttgttgag
catgccagcctgccaagccctgtgtctgtggagtggagagctcagtctgagtactcttgg
agaaaggtgctaagtggagtggtagccttcctgcttgggcttatcttccttctggtgggg
atcaccgttcatctcagggcttggaaagggtatgtggagactcagctgtctggagatgag
ttctcaagagctgtctccccaccaccgccgcactaa

KEGG   Hipposideros armiger (great roundleaf bat): 109378434
Entry
109378434         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109378434
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109378434
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109378434
   04612 Antigen processing and presentation
    109378434
   04658 Th1 and Th2 cell differentiation
    109378434
   04659 Th17 cell differentiation
    109378434
   04672 Intestinal immune network for IgA production
    109378434
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109378434
   05322 Systemic lupus erythematosus
    109378434
   05323 Rheumatoid arthritis
    109378434
   05320 Autoimmune thyroid disease
    109378434
   05321 Inflammatory bowel disease
    109378434
   05330 Allograft rejection
    109378434
   05332 Graft-versus-host disease
    109378434
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109378434
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109378434
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109378434
   05152 Tuberculosis
    109378434
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109378434
   05164 Influenza A
    109378434
   05168 Herpes simplex virus 1 infection
    109378434
   05169 Epstein-Barr virus infection
    109378434
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109378434
   05140 Leishmaniasis
    109378434
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109378434
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109378434
  Exosomal proteins of epithelial cells
   109378434
  Exosomal proteins of breast milk
   109378434
SSDB
Motif
Pfam: MHC_II_alpha C1-set FAST_1 SKG6
Other DBs
NCBI-GeneID: 109378434
NCBI-ProteinID: XP_019490368
LinkDB
Position
Un
AA seq 261 aa
MVHEQSQGAALLWLLHLLWLLPHSWTAFQAPTPGWRDDLQNHTFLHTMFCQNASPSVGLS
EAYDGDQLFSFDFSQNTRVPRLPEFADWAQKSGDTPNILFDKGFCQAMIQEIGPQLEGQI
PVSRGFPVAEVFTLKPLEFGKPNTLVCYVSNLFPPALTVNWQYYSAPVEGAGPTFVSAVD
GLSFQAFSYLNFTPAPSDLFTCTVTHEIDSYTAIAYWVPQNALPSDLLENVLCGVAFGLG
VLGIIVGLVLIIYFQRPCSSD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggttcatgagcagagccagggagctgcgctgctgtggctgctgcaccttctgtggctg
ctgccccactcgtggaccgcctttcaagctcctactccgggatggcgggatgatctgcag
aaccacacgttcctgcacacgatgttctgtcagaatgcgagtcccagcgtgggactttct
gaggcctatgatggggaccagcttttctccttcgacttttcccagaacactcgagtgcct
cgcctccctgaatttgccgactgggctcagaagtctggagatactcccaacattttattt
gacaaaggattctgccaagccatgatccaggaaataggcccacaacttgaagggcaaatc
ccagtatctagagggtttcctgtcgctgaggtgttcacgctgaagcccctggagttcggc
aagcccaacacgctggtgtgttatgtcagcaatctcttcccgcccgcactgacggtgaac
tggcagtattattcagcccctgtggaaggagccgggcccacttttgtctcagccgttgat
ggactcagcttccaggccttttcttacttaaacttcacaccggcaccctctgaccttttc
acctgcacggtgactcatgaaattgacagctacacagcaattgcctattgggttccccag
aatgcgctgccctcagatcttctggagaatgtgctgtgtggtgtggccttcggcctgggg
gtgctgggcatcattgttggcttggtcctcatcatctacttccaaagaccttgctcgagt
gactga

KEGG   Hipposideros armiger (great roundleaf bat): 109378436
Entry
109378436         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109378436
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109378436
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109378436
   04612 Antigen processing and presentation
    109378436
   04658 Th1 and Th2 cell differentiation
    109378436
   04659 Th17 cell differentiation
    109378436
   04672 Intestinal immune network for IgA production
    109378436
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109378436
   05322 Systemic lupus erythematosus
    109378436
   05323 Rheumatoid arthritis
    109378436
   05320 Autoimmune thyroid disease
    109378436
   05321 Inflammatory bowel disease
    109378436
   05330 Allograft rejection
    109378436
   05332 Graft-versus-host disease
    109378436
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109378436
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109378436
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109378436
   05152 Tuberculosis
    109378436
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109378436
   05164 Influenza A
    109378436
   05168 Herpes simplex virus 1 infection
    109378436
   05169 Epstein-Barr virus infection
    109378436
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109378436
   05140 Leishmaniasis
    109378436
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109378436
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109378436
  Exosomal proteins of epithelial cells
   109378436
  Exosomal proteins of breast milk
   109378436
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 109378436
NCBI-ProteinID: XP_019490369
LinkDB
Position
Un
AA seq 251 aa
MVLSGGMVLGLHTLMTLLSPQEAGAIKADHMASYGPAFYQSYDASGQFTHEFDGEQLFSV
ELKKREAVWRLPEFGDFTHFDPQGGLASIAVIRAHLDVLVERSNRTRAVNMPPRVTVLPK
SRVELGQPNVLICIVDNIFPPVINITWLRNGQTVTEGASQTSFYSQPDHLFRKFHYLTFV
PSADDFYDCRVEHWGLDEPLLKHWEPQVPTQLPDTTETLVCAVGLATGVVGFLVGTVLII
TGTCLFSAPRQ
NT seq 756 nt   +upstreamnt  +downstreamnt
atggtcctcagtggagggatggtcctgggactccacaccttgatgaccctcctgagcccc
caggaagctggggccatcaaggctgaccacatggcgtcctacggaccagccttctaccag
tcctatgatgcctcggggcagttcacccacgagtttgatggggaacagctgttctctgtg
gagctgaagaagagggaggctgtgtggcgtctgcccgagtttggcgacttcacccacttt
gaccctcagggtgggctggccagcattgcagtgatcagagctcatctggacgtcctggtg
gaacgctccaatcgcaccagagccgtcaacatgcctccaagggtgaccgtactccccaag
tctcgagtggagctgggccagcccaatgtcctcatctgcatcgtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaatggtcaaacagtcaccgagggggcgtcccaa
accagcttctattcccagcctgaccatttgttccgcaagttccactacctgaccttcgtg
ccctcagcagacgacttctacgactgccgggtggaacactggggactggacgagccgctc
ctcaagcactgggagccccaggtgcctactcagctgccagatactacagagaccctggtc
tgtgccgtgggcctggccaccggcgtggtgggcttcctcgtgggcaccgtcctcatcatc
acaggcacatgcttgttcagtgcccctaggcaatga

KEGG   Hipposideros armiger (great roundleaf bat): 109378577
Entry
109378577         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109378577
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109378577
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109378577
   04612 Antigen processing and presentation
    109378577
   04658 Th1 and Th2 cell differentiation
    109378577
   04659 Th17 cell differentiation
    109378577
   04672 Intestinal immune network for IgA production
    109378577
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109378577
   05322 Systemic lupus erythematosus
    109378577
   05323 Rheumatoid arthritis
    109378577
   05320 Autoimmune thyroid disease
    109378577
   05321 Inflammatory bowel disease
    109378577
   05330 Allograft rejection
    109378577
   05332 Graft-versus-host disease
    109378577
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109378577
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109378577
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109378577
   05152 Tuberculosis
    109378577
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109378577
   05164 Influenza A
    109378577
   05168 Herpes simplex virus 1 infection
    109378577
   05169 Epstein-Barr virus infection
    109378577
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109378577
   05140 Leishmaniasis
    109378577
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109378577
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109378577
  Exosomal proteins of epithelial cells
   109378577
  Exosomal proteins of breast milk
   109378577
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig I-set C2-set_2
Other DBs
NCBI-GeneID: 109378577
NCBI-ProteinID: XP_019490449
LinkDB
Position
Un
AA seq 263 aa
MTTLLQLLLVLSLGCTGAGGFVAHVESTCLLDDNGTPQDFTYCVSFNKDLLTCWDPKEGQ
MAPCEFGTLNMLATYLSDYLNKQKGLLQRLSEGLQDCATHTKPFWGSLTHRTRPPSVQVA
KTTPFNTREPVMLACYVSGFYPADVTITWRKNGQLVPPHGSAHKIAQPNGDWTYQTLSHL
ATTPSFWDTYTCVVEHIGSPEPIRQDWTPGLSPAQTAKVSVSAVTLGLGLIIFSLGLLRC
RRAGSSGYTSLPGANYPEGRHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaccacactcctgcagctgctgctagtccttagcctgggctgcaccggagcagggggc
tttgtggcccatgtggaaagcacctgtctgttggatgacaatgggacgccacaggatttc
acgtattgtgtttccttcaacaaagatctgctgacttgctgggatccaaaggagggccaa
atggccccttgtgaatttgggacactgaatatgttggccacctacctgtcagactacctc
aacaagcagaaaggcctgctccagcgcttatctgaggggctccaggactgtgccacacac
acaaagcccttctggggatcactgacccacaggacgcggccaccatctgtgcaagtagcc
aaaaccactccttttaacacgagggagcccgtgatgctggcctgctatgtgtcgggcttc
tatccagcagatgtgaccatcacatggaggaagaacgggcagcttgtgccccctcatggc
agtgcccacaagattgcccagcccaatggagactggacgtaccagaccctctcccattta
gccacaaccccctctttctgggatacctacacctgtgtggtggagcacattgggtctcca
gagcccatccgtcaagactggacacctgggctgtccccggcacagacagcgaaggtctct
gtgtctgcagtgactctgggcctgggcctcatcatcttctctcttggtttgctccgctgt
cggagagctggctcctctggctatacttccctccctggggccaattatccagaaggtcgg
cacatttcctag

KEGG   Hipposideros armiger (great roundleaf bat): 109392411
Entry
109392411         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109392411
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109392411
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109392411
   04612 Antigen processing and presentation
    109392411
   04658 Th1 and Th2 cell differentiation
    109392411
   04659 Th17 cell differentiation
    109392411
   04672 Intestinal immune network for IgA production
    109392411
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109392411
   05322 Systemic lupus erythematosus
    109392411
   05323 Rheumatoid arthritis
    109392411
   05320 Autoimmune thyroid disease
    109392411
   05321 Inflammatory bowel disease
    109392411
   05330 Allograft rejection
    109392411
   05332 Graft-versus-host disease
    109392411
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109392411
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109392411
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109392411
   05152 Tuberculosis
    109392411
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109392411
   05164 Influenza A
    109392411
   05168 Herpes simplex virus 1 infection
    109392411
   05169 Epstein-Barr virus infection
    109392411
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109392411
   05140 Leishmaniasis
    109392411
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109392411
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109392411
  Exosomal proteins of epithelial cells
   109392411
  Exosomal proteins of breast milk
   109392411
SSDB
Motif
Pfam: C1-set MHC_II_beta ig Ig_3 MHC_I C2-set_2
Other DBs
NCBI-GeneID: 109392411
NCBI-ProteinID: XP_019516382
LinkDB
Position
Un
AA seq 268 aa
MALGVDTQLQGEGLTQGSGRASCGCWGLSQLCPALASPSPEFYVYQRRSNCFEFNGTHRF
LEQYAYNREVYIRFDSAVGVFVAVTELGRITAKNWNIQREFLELRKSAVDTACRHNYELD
KGFTLKRRVQPKVNVSPSKKGLLQHHNLLVCHVTDFYPGDIQVCWFLNGQEETAGVVSTT
PIHNGDWTFQILVMLEMTPQQGDVYICQVEHPSLDSPVTVEWRVQSASARSKMLTGVGGF
VLGLTALMLSFTLHFKGQRVQANQLLSQ
NT seq 807 nt   +upstreamnt  +downstreamnt
atggccctgggtgtagacactcaacttcagggtgaagggcttacccagggaagtggccga
gcgtcctgtgggtgctggggcctctcccagctctgccctgccctggcctctccctctcca
gagttttacgtgtaccagagaaggagcaactgctttgagttcaatgggacacaccgcttc
ttggagcaatacgcttacaacagagaagtgtacatccggtttgacagtgccgtgggggtg
tttgtggctgtgactgagctcgggcgcataactgccaagaactggaacatccagagagag
ttcctggagctgagaaagagtgccgtggacacagcgtgcagacacaactacgagttggac
aagggtttcacgctgaagcgcagagtccagccgaaagtgaacgtctccccctccaagaag
gggctcctgcagcaccacaacctgcttgtctgccacgtgacagatttctatccaggagac
attcaagtctgctggttcctaaacggacaggaggaaacagctggggttgtgtccaccacc
ccgatccataatggagactggaccttccagatcctggtgatgctggaaatgaccccccag
cagggagacgtctacatctgccaagtggaacaccccagcttggacagtcctgtcactgta
gagtggagggtgcagtcagcttcagccaggagcaagatgctgactggagttgggggcttt
gtgctggggctcactgccctcatgctgagcttcactctccatttcaaaggccaacgagtt
caggctaaccagctcctcagccaatag

KEGG   Hipposideros armiger (great roundleaf bat): 109392415
Entry
109392415         CDS       T04661                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04145  Phagosome
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04640  Hematopoietic cell lineage
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05150  Staphylococcus aureus infection
hai05152  Tuberculosis
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109392415
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109392415
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109392415
   04612 Antigen processing and presentation
    109392415
   04658 Th1 and Th2 cell differentiation
    109392415
   04659 Th17 cell differentiation
    109392415
   04672 Intestinal immune network for IgA production
    109392415
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109392415
   05322 Systemic lupus erythematosus
    109392415
   05323 Rheumatoid arthritis
    109392415
   05320 Autoimmune thyroid disease
    109392415
   05321 Inflammatory bowel disease
    109392415
   05330 Allograft rejection
    109392415
   05332 Graft-versus-host disease
    109392415
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109392415
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109392415
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109392415
   05152 Tuberculosis
    109392415
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109392415
   05164 Influenza A
    109392415
   05168 Herpes simplex virus 1 infection
    109392415
   05169 Epstein-Barr virus infection
    109392415
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109392415
   05140 Leishmaniasis
    109392415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109392415
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109392415
  Exosomal proteins of epithelial cells
   109392415
  Exosomal proteins of breast milk
   109392415
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Other DBs
NCBI-GeneID: 109392415
NCBI-ProteinID: XP_019516391
LinkDB
Position
Un
AA seq 266 aa
MPPEDRRSQTRVMILKAITLTTLLSPHGTGAIRGDHVSTYAEFVQTHRPSGEYMFEFDED
EQFYMDLDKKETVWHLPEFIHAFDYDARRDIADIVMARKNLNTMIQWSNHTRATSEPPEV
TVFPKEPVELGQPNTLICHVDKFFPPVLNVTWLRNGQMVTKGVAETIFLPSTEFRFHKFH
YLTFLPMAEDVYDCRVEHWDLDQPLLRHWEAQEPVQVPETMETVVCALGLVVGLAGIITG
AITLKTRRPDSIRGCRGPCESSQMWG
NT seq 801 nt   +upstreamnt  +downstreamnt
atgccacctgaagacagaaggagccagaccagagtcatgatcttgaaagccatcaccctg
actaccctgctgagtccccatggcactggggccatcaggggtgaccatgtgtcaacctat
gccgagtttgtccagacacacagaccctctggggagtacatgtttgaatttgatgaggat
gagcagttctatatggacctggataagaaggaaactgtctggcatctgcccgagtttatt
catgcctttgactatgatgctcggagggatattgctgacattgtcatggcaaggaagaac
ttgaacaccatgatccaatggtccaaccacaccagggccacaagtgagcctcctgaggtg
accgtgtttcccaaggagcctgtggagctgggtcagcccaacactctcatctgccacgtg
gacaagttcttcccacccgtgctcaatgtcacatggctgcgcaatgggcagatggtaacc
aagggggtggctgaaaccatcttcctgcctagcacagaattcagattccacaagttccac
tacctgacctttcttcccatggccgaggacgtctacgactgcagggtggaacactgggac
ctggaccagccgctcctcaggcactgggaggcccaggagccggtccaggtgcctgagacg
atggagactgtggtctgtgccctgggcctggtggtgggcctggcaggaatcatcactggc
gccatcaccctgaagaccaggcgacctgacagcattcgcgggtgcaggggcccctgtgag
tcatcccagatgtgggggtga

DBGET integrated database retrieval system