KEGG   Hipposideros armiger (great roundleaf bat): 109373073
Entry
109373073         CDS       T04661                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01523  Antifolate resistance
hai04010  MAPK signaling pathway
hai04060  Cytokine-cytokine receptor interaction
hai04061  Viral protein interaction with cytokine and cytokine receptor
hai04064  NF-kappa B signaling pathway
hai04071  Sphingolipid signaling pathway
hai04150  mTOR signaling pathway
hai04210  Apoptosis
hai04217  Necroptosis
hai04350  TGF-beta signaling pathway
hai04380  Osteoclast differentiation
hai04612  Antigen processing and presentation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04640  Hematopoietic cell lineage
hai04650  Natural killer cell mediated cytotoxicity
hai04657  IL-17 signaling pathway
hai04660  T cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04668  TNF signaling pathway
hai04920  Adipocytokine signaling pathway
hai04930  Type II diabetes mellitus
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04940  Type I diabetes mellitus
hai05010  Alzheimer disease
hai05014  Amyotrophic lateral sclerosis
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05132  Salmonella infection
hai05133  Pertussis
hai05134  Legionellosis
hai05135  Yersinia infection
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05143  African trypanosomiasis
hai05144  Malaria
hai05145  Toxoplasmosis
hai05146  Amoebiasis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05205  Proteoglycans in cancer
hai05310  Asthma
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05410  Hypertrophic cardiomyopathy
hai05414  Dilated cardiomyopathy
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109373073 (TNF)
   04350 TGF-beta signaling pathway
    109373073 (TNF)
   04064 NF-kappa B signaling pathway
    109373073 (TNF)
   04668 TNF signaling pathway
    109373073 (TNF)
   04071 Sphingolipid signaling pathway
    109373073 (TNF)
   04150 mTOR signaling pathway
    109373073 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109373073 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109373073 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109373073 (TNF)
   04217 Necroptosis
    109373073 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109373073 (TNF)
   04620 Toll-like receptor signaling pathway
    109373073 (TNF)
   04621 NOD-like receptor signaling pathway
    109373073 (TNF)
   04622 RIG-I-like receptor signaling pathway
    109373073 (TNF)
   04625 C-type lectin receptor signaling pathway
    109373073 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    109373073 (TNF)
   04612 Antigen processing and presentation
    109373073 (TNF)
   04660 T cell receptor signaling pathway
    109373073 (TNF)
   04657 IL-17 signaling pathway
    109373073 (TNF)
   04664 Fc epsilon RI signaling pathway
    109373073 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109373073 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109373073 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109373073 (TNF)
  09163 Immune disease
   05310 Asthma
    109373073 (TNF)
   05322 Systemic lupus erythematosus
    109373073 (TNF)
   05323 Rheumatoid arthritis
    109373073 (TNF)
   05321 Inflammatory bowel disease
    109373073 (TNF)
   05330 Allograft rejection
    109373073 (TNF)
   05332 Graft-versus-host disease
    109373073 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109373073 (TNF)
   05014 Amyotrophic lateral sclerosis
    109373073 (TNF)
   05020 Prion disease
    109373073 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    109373073 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109373073 (TNF)
   05410 Hypertrophic cardiomyopathy
    109373073 (TNF)
   05414 Dilated cardiomyopathy
    109373073 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109373073 (TNF)
   04940 Type I diabetes mellitus
    109373073 (TNF)
   04932 Non-alcoholic fatty liver disease
    109373073 (TNF)
   04931 Insulin resistance
    109373073 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109373073 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109373073 (TNF)
   05135 Yersinia infection
    109373073 (TNF)
   05133 Pertussis
    109373073 (TNF)
   05134 Legionellosis
    109373073 (TNF)
   05152 Tuberculosis
    109373073 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109373073 (TNF)
   05170 Human immunodeficiency virus 1 infection
    109373073 (TNF)
   05164 Influenza A
    109373073 (TNF)
   05161 Hepatitis B
    109373073 (TNF)
   05160 Hepatitis C
    109373073 (TNF)
   05168 Herpes simplex virus 1 infection
    109373073 (TNF)
   05163 Human cytomegalovirus infection
    109373073 (TNF)
   05169 Epstein-Barr virus infection
    109373073 (TNF)
   05165 Human papillomavirus infection
    109373073 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109373073 (TNF)
   05144 Malaria
    109373073 (TNF)
   05145 Toxoplasmosis
    109373073 (TNF)
   05140 Leishmaniasis
    109373073 (TNF)
   05142 Chagas disease
    109373073 (TNF)
   05143 African trypanosomiasis
    109373073 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109373073 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109373073 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109373073 (TNF)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Tumor necrosis fators
   109373073 (TNF)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Cytokines
   109373073 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 109373073
NCBI-ProteinID: XP_019482193
LinkDB
Position
Un
AA seq 233 aa
MSTESMIRDVELAEEALPKKAGGPHGFRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR
EEFPADLQLINPLAHTLGVSSRTPSDKPVAHVVANLETEGQLQWLSRRANALLANGVLLT
DNQLVVPLDGLYLIYSQVLFKGQGCPQSHVLLTHTISRFAVSYPYKVNLLSAIKSPCQRE
TADGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPEYLDVAEPGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggctgaggaggcgctccccaagaag
gcagggggcccccacggcttcagacggtgcttgtgcctcagcctcttctccttcctcctc
gtggcaggagccaccacgctcttctgcctgctgcacttcggggtgatcggcccccagagg
gaagagttcccagctgacctccagttaatcaaccctctggcccacacacttggagtgtct
tctcgaacccccagtgacaagcctgtcgcccacgttgtagcaaaccttgaaactgaggga
cagctccagtggttgagccggcgtgccaatgccctcttggccaatggcgtgttgctgaca
gacaaccagctggtggtgcctttggatgggctgtacctcatctactcccaggtcctcttc
aagggtcaaggctgccctcaaagccatgtgctcctcactcacaccatcagccgctttgcc
gtctcctacccgtacaaggtcaacctcctgtctgccatcaagagcccttgccagagggag
acagcagatggggctgaggccaagccctggtacgaacccatctacctgggaggggtcttc
cagctggagaagggtgatcgactcagtgctgagatcaacctgcctgagtatctcgatgtt
gcggaacccgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system