KEGG   Hipposideros armiger (great roundleaf bat): 109373089
Entry
109373089         CDS       T04661                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04022  cGMP-PKG signaling pathway
hai04141  Protein processing in endoplasmic reticulum
hai04151  PI3K-Akt signaling pathway
hai04211  Longevity regulating pathway
hai04261  Adrenergic signaling in cardiomyocytes
hai04668  TNF signaling pathway
hai04728  Dopaminergic synapse
hai04911  Insulin secretion
hai04915  Estrogen signaling pathway
hai04918  Thyroid hormone synthesis
hai04925  Aldosterone synthesis and secretion
hai04926  Relaxin signaling pathway
hai04927  Cortisol synthesis and secretion
hai04928  Parathyroid hormone synthesis, secretion and action
hai04934  Cushing syndrome
hai04935  Growth hormone synthesis, secretion and action
hai05020  Prion disease
hai05030  Cocaine addiction
hai05031  Amphetamine addiction
hai05034  Alcoholism
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109373089 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109373089 (ATF6B)
   04022 cGMP-PKG signaling pathway
    109373089 (ATF6B)
   04151 PI3K-Akt signaling pathway
    109373089 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109373089 (ATF6B)
   04915 Estrogen signaling pathway
    109373089 (ATF6B)
   04926 Relaxin signaling pathway
    109373089 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    109373089 (ATF6B)
   04918 Thyroid hormone synthesis
    109373089 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    109373089 (ATF6B)
   04925 Aldosterone synthesis and secretion
    109373089 (ATF6B)
   04927 Cortisol synthesis and secretion
    109373089 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109373089 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    109373089 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    109373089 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109373089 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    109373089 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    109373089 (ATF6B)
   05031 Amphetamine addiction
    109373089 (ATF6B)
   05034 Alcoholism
    109373089 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109373089 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109373089 (ATF6B)
   05161 Hepatitis B
    109373089 (ATF6B)
   05163 Human cytomegalovirus infection
    109373089 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109373089 (ATF6B)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109373089 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 109373089
NCBI-ProteinID: XP_019482224
LinkDB
Position
Un
AA seq 699 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGVRNCTLYTGLDEVAEEQTQLFRCPEQDVPFGS
SMLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSSQAPGVGE
VLVVKIESLAPPLCLLGDDPTSPFETVHINVGPTSDNPSDAHTKTEPVSPSSSIHSEASL
LSAESPNQPFIGEEVLEVKTESPSPQGCLLRDVPGAPLGAVQISMGPSPDGSSGKALPSR
KPPLQPKPVVITTVPVPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGPAPPAP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKAVCIMVFLLFIAFNFGPVSISEPP
SAPASPRMSGDEPRPRRHLLEFSAQLPVHGVEPPRGPEEPQPSPEARPSFRNLTAFPGGA
KELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQLRK
KSPPVKAVPTQPPGTPERDAVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRDHLLL
PAISHNKTSRPKMSLVMPAMAPNETLSGRGSPGDYEEMMQIECEVMGTRVIHIKTSTVPP
SLRKQPSSSPGNATGGPLAASAASQAHQAAHRPLYLNHP
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcggaactgatgctcctcagcgagattgcggacccgactcgttttttcaccgacaac
ttgctgagcccggaggactggggtgtgcggaactgcaccttgtacaccggcctggatgaa
gtggccgaggagcagacgcagctcttccgttgcccggagcaggatgtcccgtttggcagc
agcatgctggatgtggggatggatgtcagcccccctgagcccccatgggaccccctgcct
atcttcccagatcttcaggtgaagtctgagccatcctctccctgctcctcctcctctctc
agctccgaatcatcacatctttccacagagccctccagccaggcccctggtgtaggggag
gtgctggttgtgaagatagagtccttggcacccccactttgcctcctgggagatgatcca
acatccccgtttgaaacagtccacatcaatgtgggccccacctctgataatccctcagat
gcccataccaagacagaacctgtctctccatcttcctccatccactcagaggcgtccctg
ctctcagcagagtcccctaaccagcctttcataggagaggaggtactggaagtgaagaca
gagtccccatcccctcaagggtgtctcctgcgggatgtcccaggcgccccactcggagct
gtccagatcagcatgggtccatcccccgatggctcctcaggcaaagccctgccttcccgg
aagccaccactgcagcccaaacctgtggtgataaccaccgtcccagtgccacccagagcc
gtgcctcctagcaccaccgtccttttgcagccccttgtccagccacccccagtgtcccca
gtggtcctcatccaaggtgctattcgagtccagcctgaggggccggctccccctgcgcca
cggcctgaaaggaagagcattgttccagctcctatgcctgggaactcctgcccgcctgaa
gtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcggcctgc
cagtcgcggaggaagaagaaggaatacttgcaggggctggaggcccggctgcaggcagtg
ctggccgacaaccagcagctgcgccgggagaatgctgccctccggcggcggctggaggcc
ctgctggccgagaacagcgagctcaagttagggtccggaaacaggaaggcggtctgcatc
atggtcttccttctcttcattgccttcaacttcgggcctgtcagcatcagtgagcctcct
tcagctcccgcctctcctcgcatgagcggagacgagccccgaccccggagacacttactc
gagttctcagcgcaattgccggttcacggagttgagccgccccggggccccgaggagccc
cagcccagccctgaagcccggccaagtttcaggaacctgacagccttccccgggggtgcc
aaggagctgctgctgagagacctggaccagctcttcctctcctctgactgccggcacttc
aaccgaacggagtctctgaggcttgctgatgagctgagcggctgggtgcagcgtcaccag
agaggccggcggaagatcccccagagggcccaggagagacagaagtctcagctacggaag
aagtcacctccagttaaggcagtccccacccaaccccctgggaccccagagagggacgct
gtgggccagctgcagctgtatcgccacccagaccgttcacaaccagagttcctggatgca
atcgaccgacgggaagacacattttatgttgtctccttccgacgggaccacttgctgctc
ccagccatcagccacaataagacctctcggcccaagatgtccctggtgatgcctgccatg
gcccccaatgagaccctgtcaggccgggggtcccctggggactatgaggagatgatgcag
atcgagtgtgaggtcatgggcaccagggtgattcacatcaagacctccacggtgcccccc
tcactccgaaaacagccgtcctcgtccccgggcaatgccacagggggccccttggcagcc
tctgcagccagccaggcgcaccaggctgcccatcggcccctctacctcaatcatccctga

DBGET integrated database retrieval system